Basic Information | |
---|---|
Family ID | F030933 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 184 |
Average Sequence Length | 43 residues |
Representative Sequence | MIDNHQPDELQRKRAQAVKTAWVLGIIAAAIFATFIGSAVIGR |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 184 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 70.65 % |
% of genes near scaffold ends (potentially truncated) | 16.85 % |
% of genes from short scaffolds (< 2000 bps) | 69.02 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.304 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow (13.587 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.696 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (28.804 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 184 Family Scaffolds |
---|---|---|
PF04442 | CtaG_Cox11 | 39.67 |
PF00115 | COX1 | 32.07 |
PF00510 | COX3 | 10.87 |
PF01040 | UbiA | 2.72 |
PF02104 | SURF1 | 2.17 |
PF02790 | COX2_TM | 1.63 |
PF11137 | DUF2909 | 1.63 |
PF14850 | Pro_dh-DNA_bdg | 0.54 |
PF13180 | PDZ_2 | 0.54 |
PF16537 | T2SSB | 0.54 |
PF13442 | Cytochrome_CBB3 | 0.54 |
PF13669 | Glyoxalase_4 | 0.54 |
PF00116 | COX2 | 0.54 |
PF00271 | Helicase_C | 0.54 |
PF02628 | COX15-CtaA | 0.54 |
PF13401 | AAA_22 | 0.54 |
COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
---|---|---|---|
COG3175 | Cytochrome c oxidase assembly protein Cox11 | Posttranslational modification, protein turnover, chaperones [O] | 39.67 |
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 10.87 |
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 2.17 |
COG3346 | Cytochrome oxidase assembly protein ShyY1 | Posttranslational modification, protein turnover, chaperones [O] | 2.17 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.54 |
COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.54 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.30 % |
Unclassified | root | N/A | 8.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000119|KGI_S1_ANT01_95mDRAFT_c10012272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3858 | Open in IMG/M |
3300000119|KGI_S1_ANT01_95mDRAFT_c10021560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2696 | Open in IMG/M |
3300000119|KGI_S1_ANT01_95mDRAFT_c10074427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 1082 | Open in IMG/M |
3300000120|SA_S2_NOR13_50mDRAFT_c1005212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2552 | Open in IMG/M |
3300000124|BS_KBA_SWE12_21mDRAFT_c10000229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 19586 | Open in IMG/M |
3300000124|BS_KBA_SWE12_21mDRAFT_c10026014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1750 | Open in IMG/M |
3300000127|SA_S1_NOR05_45mDRAFT_c10006040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3828 | Open in IMG/M |
3300000130|SA_S2_NOR15_50mDRAFT_c10029468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2434 | Open in IMG/M |
3300000130|SA_S2_NOR15_50mDRAFT_c10034623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2205 | Open in IMG/M |
3300000130|SA_S2_NOR15_50mDRAFT_c10129164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus oceani | 865 | Open in IMG/M |
3300000130|SA_S2_NOR15_50mDRAFT_c10188232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
3300000241|BS_KBA_SWE21_205mDRAFT_10000133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 22945 | Open in IMG/M |
3300000241|BS_KBA_SWE21_205mDRAFT_10090465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 665 | Open in IMG/M |
3300001390|SMAR1_101000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 2861 | Open in IMG/M |
3300001750|JGI24023J19991_10078822 | Not Available | 1149 | Open in IMG/M |
3300002231|KVRMV2_100042292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 7792 | Open in IMG/M |
3300003885|Ga0063294_10038118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3221 | Open in IMG/M |
3300003885|Ga0063294_10057130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 2586 | Open in IMG/M |
3300003885|Ga0063294_10373547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 870 | Open in IMG/M |
3300003886|Ga0063293_10001609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 24263 | Open in IMG/M |
3300003886|Ga0063293_10103460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 2241 | Open in IMG/M |
3300003886|Ga0063293_10242049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1317 | Open in IMG/M |
3300004030|Ga0055444_10006079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 3125 | Open in IMG/M |
3300004030|Ga0055444_10436707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
3300004050|Ga0055491_10109224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 692 | Open in IMG/M |
3300004056|Ga0055478_10003339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 2861 | Open in IMG/M |
3300004056|Ga0055478_10011470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1864 | Open in IMG/M |
3300004097|Ga0055584_100810416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 979 | Open in IMG/M |
3300004097|Ga0055584_101163308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 805 | Open in IMG/M |
3300004097|Ga0055584_102060656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
3300004097|Ga0055584_102455761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 527 | Open in IMG/M |
3300004097|Ga0055584_102651817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 503 | Open in IMG/M |
3300004147|Ga0055515_10244461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 527 | Open in IMG/M |
3300004147|Ga0055515_10256518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 517 | Open in IMG/M |
3300004148|Ga0055521_10247896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300005588|Ga0070728_10051408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 2671 | Open in IMG/M |
3300005590|Ga0070727_10041028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 2837 | Open in IMG/M |
3300005590|Ga0070727_10696268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 570 | Open in IMG/M |
3300005612|Ga0070723_10407434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 659 | Open in IMG/M |
3300006465|Ga0082250_10842449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 539 | Open in IMG/M |
3300006467|Ga0099972_10386631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 3501 | Open in IMG/M |
3300006467|Ga0099972_11643294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1239 | Open in IMG/M |
3300006467|Ga0099972_12506982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1901 | Open in IMG/M |
3300006467|Ga0099972_13013476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3363 | Open in IMG/M |
3300007614|Ga0102946_1000411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 14948 | Open in IMG/M |
3300007614|Ga0102946_1095162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1000 | Open in IMG/M |
3300007778|Ga0102954_1092527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 847 | Open in IMG/M |
3300007778|Ga0102954_1121272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 741 | Open in IMG/M |
3300007784|Ga0102955_1087923 | Not Available | 795 | Open in IMG/M |
3300008464|Ga0115336_109668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2498 | Open in IMG/M |
3300009027|Ga0102957_1123832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 909 | Open in IMG/M |
3300009030|Ga0114950_10043038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3552 | Open in IMG/M |
3300009030|Ga0114950_10601897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
3300009035|Ga0102958_1060723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1122 | Open in IMG/M |
3300009075|Ga0105090_10007748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6309 | Open in IMG/M |
3300009080|Ga0102815_10322702 | Not Available | 854 | Open in IMG/M |
3300009086|Ga0102812_10019571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 3918 | Open in IMG/M |
3300009102|Ga0114948_10204253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1415 | Open in IMG/M |
3300009138|Ga0102959_1076440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 963 | Open in IMG/M |
3300009509|Ga0123573_10092277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3113 | Open in IMG/M |
3300009509|Ga0123573_10979298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 790 | Open in IMG/M |
3300009509|Ga0123573_11659730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 593 | Open in IMG/M |
3300009509|Ga0123573_11869123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 554 | Open in IMG/M |
3300010234|Ga0136261_1048364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 925 | Open in IMG/M |
3300010392|Ga0118731_100855953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3160 | Open in IMG/M |
3300010392|Ga0118731_102858209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7423 | Open in IMG/M |
3300010392|Ga0118731_103225158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1592 | Open in IMG/M |
3300010392|Ga0118731_108559783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 2171 | Open in IMG/M |
3300010392|Ga0118731_111014920 | Not Available | 739 | Open in IMG/M |
3300010392|Ga0118731_115461691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5994 | Open in IMG/M |
3300010412|Ga0136852_10333624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1489 | Open in IMG/M |
3300010430|Ga0118733_100090440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6204 | Open in IMG/M |
3300010430|Ga0118733_100151499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 4625 | Open in IMG/M |
3300010430|Ga0118733_100765913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1924 | Open in IMG/M |
3300010430|Ga0118733_102130780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1113 | Open in IMG/M |
3300010430|Ga0118733_102798174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 961 | Open in IMG/M |
3300010430|Ga0118733_103233593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 889 | Open in IMG/M |
3300010430|Ga0118733_105774348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 650 | Open in IMG/M |
3300010430|Ga0118733_106100896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 631 | Open in IMG/M |
3300010430|Ga0118733_108760223 | Not Available | 522 | Open in IMG/M |
3300011125|Ga0151663_1072933 | Not Available | 984 | Open in IMG/M |
3300011256|Ga0151664_1004917 | Not Available | 1352 | Open in IMG/M |
3300013098|Ga0164320_10135107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1097 | Open in IMG/M |
3300013098|Ga0164320_10305069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 767 | Open in IMG/M |
3300013099|Ga0164315_10000918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 21541 | Open in IMG/M |
3300013099|Ga0164315_10129289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella | 2051 | Open in IMG/M |
3300013099|Ga0164315_10646668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 850 | Open in IMG/M |
3300013099|Ga0164315_10702114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 811 | Open in IMG/M |
3300013099|Ga0164315_11256818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 584 | Open in IMG/M |
3300013101|Ga0164313_10011992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7500 | Open in IMG/M |
3300013101|Ga0164313_10024860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5085 | Open in IMG/M |
3300013101|Ga0164313_10574815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 934 | Open in IMG/M |
3300013101|Ga0164313_10770570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 790 | Open in IMG/M |
3300013101|Ga0164313_10834184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 755 | Open in IMG/M |
3300013101|Ga0164313_11343728 | Not Available | 577 | Open in IMG/M |
3300013315|Ga0173609_10098376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1995 | Open in IMG/M |
3300014306|Ga0075346_1088220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 661 | Open in IMG/M |
3300019750|Ga0194000_1020330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Wenzhouxiangellaceae → Wenzhouxiangella → Wenzhouxiangella marina | 852 | Open in IMG/M |
3300020234|Ga0212227_1451106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2599 | Open in IMG/M |
3300020235|Ga0212228_1139360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2428 | Open in IMG/M |
3300020235|Ga0212228_1197245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2849 | Open in IMG/M |
3300020235|Ga0212228_1315230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Wenzhouxiangellaceae → Wenzhouxiangella → Wenzhouxiangella marina | 6495 | Open in IMG/M |
3300021514|Ga0190293_1000420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 15101 | Open in IMG/M |
3300021514|Ga0190293_1001766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7505 | Open in IMG/M |
3300021514|Ga0190293_1091433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 842 | Open in IMG/M |
3300022206|Ga0224499_10005493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3507 | Open in IMG/M |
3300022206|Ga0224499_10036588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1587 | Open in IMG/M |
3300022217|Ga0224514_10153768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 809 | Open in IMG/M |
3300022217|Ga0224514_10179084 | Not Available | 752 | Open in IMG/M |
3300022218|Ga0224502_10237024 | Not Available | 701 | Open in IMG/M |
3300023368|Ga0256753_1007842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3370 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10072470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1306 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10038957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1766 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10209625 | Not Available | 816 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10412434 | Not Available | 585 | Open in IMG/M |
(restricted) 3300024338|Ga0255043_10339885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 522 | Open in IMG/M |
(restricted) 3300024340|Ga0255042_10249024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 570 | Open in IMG/M |
3300024343|Ga0244777_10604794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 664 | Open in IMG/M |
(restricted) 3300024517|Ga0255049_10006639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 5504 | Open in IMG/M |
(restricted) 3300024517|Ga0255049_10085825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1428 | Open in IMG/M |
(restricted) 3300024529|Ga0255044_10087952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 1110 | Open in IMG/M |
(restricted) 3300024529|Ga0255044_10108519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1019 | Open in IMG/M |
3300025599|Ga0210074_1000920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9647 | Open in IMG/M |
3300025793|Ga0210065_1007606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2059 | Open in IMG/M |
3300025883|Ga0209456_10097915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1297 | Open in IMG/M |
3300026131|Ga0209928_1043547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 675 | Open in IMG/M |
3300026135|Ga0209939_1037613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 934 | Open in IMG/M |
3300027683|Ga0209392_1000505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9053 | Open in IMG/M |
3300027820|Ga0209578_10067784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1796 | Open in IMG/M |
3300027828|Ga0209692_10127154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1223 | Open in IMG/M |
3300027834|Ga0209344_10027071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3522 | Open in IMG/M |
(restricted) 3300027837|Ga0255041_10177184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 744 | Open in IMG/M |
(restricted) 3300027837|Ga0255041_10260638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 621 | Open in IMG/M |
(restricted) 3300027837|Ga0255041_10330366 | Not Available | 554 | Open in IMG/M |
(restricted) 3300027837|Ga0255041_10366775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 527 | Open in IMG/M |
3300027845|Ga0209271_10111556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
3300027858|Ga0209013_10223590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1121 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10293080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 767 | Open in IMG/M |
3300028598|Ga0265306_10067396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1799 | Open in IMG/M |
3300028598|Ga0265306_10659621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 577 | Open in IMG/M |
3300028599|Ga0265309_10544547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 776 | Open in IMG/M |
3300031665|Ga0316575_10111735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1115 | Open in IMG/M |
3300031727|Ga0316576_10156594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1717 | Open in IMG/M |
3300031965|Ga0326597_10557743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1235 | Open in IMG/M |
3300032136|Ga0316201_10000972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 18280 | Open in IMG/M |
3300032136|Ga0316201_10001865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 14637 | Open in IMG/M |
3300032136|Ga0316201_10005094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10051 | Open in IMG/M |
3300032136|Ga0316201_10039064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 4105 | Open in IMG/M |
3300032136|Ga0316201_10058092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3357 | Open in IMG/M |
3300032136|Ga0316201_10190575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1785 | Open in IMG/M |
3300032136|Ga0316201_10229081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1613 | Open in IMG/M |
3300032136|Ga0316201_10298009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1395 | Open in IMG/M |
3300032136|Ga0316201_10452278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1104 | Open in IMG/M |
3300032136|Ga0316201_10615770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 927 | Open in IMG/M |
3300032168|Ga0316593_10028009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1813 | Open in IMG/M |
3300032231|Ga0316187_10000167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 44685 | Open in IMG/M |
3300032231|Ga0316187_10135903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1920 | Open in IMG/M |
3300032231|Ga0316187_10142018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1873 | Open in IMG/M |
3300032231|Ga0316187_10165690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1717 | Open in IMG/M |
3300032231|Ga0316187_10207885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1510 | Open in IMG/M |
3300032231|Ga0316187_10313290 | Not Available | 1195 | Open in IMG/M |
3300032231|Ga0316187_10876345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 660 | Open in IMG/M |
3300032251|Ga0316198_10141411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1413 | Open in IMG/M |
3300032251|Ga0316198_10726301 | Not Available | 530 | Open in IMG/M |
3300032252|Ga0316196_10418068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 573 | Open in IMG/M |
3300032258|Ga0316191_10123198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1896 | Open in IMG/M |
3300032258|Ga0316191_10233056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1342 | Open in IMG/M |
3300032259|Ga0316190_10114119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1891 | Open in IMG/M |
3300032260|Ga0316192_10208353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1357 | Open in IMG/M |
3300032260|Ga0316192_10752633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 656 | Open in IMG/M |
3300032260|Ga0316192_10866456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 606 | Open in IMG/M |
3300032260|Ga0316192_10979903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 566 | Open in IMG/M |
3300032262|Ga0316194_10096411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1911 | Open in IMG/M |
3300032263|Ga0316195_10058220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1993 | Open in IMG/M |
3300032263|Ga0316195_10347302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 783 | Open in IMG/M |
3300032263|Ga0316195_10466160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 671 | Open in IMG/M |
3300032276|Ga0316188_10002319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9125 | Open in IMG/M |
3300033429|Ga0316193_10043109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3507 | Open in IMG/M |
3300033429|Ga0316193_10338565 | Not Available | 1194 | Open in IMG/M |
3300033429|Ga0316193_10402690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
3300033429|Ga0316193_10937832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 689 | Open in IMG/M |
3300033429|Ga0316193_11330137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 570 | Open in IMG/M |
3300033488|Ga0316621_10421300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
3300033541|Ga0316596_1223489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 527 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 13.59% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 8.70% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 7.07% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 6.52% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.52% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 5.43% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.43% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 4.89% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.80% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.26% |
Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents | 3.26% |
Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 2.72% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 2.72% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 2.72% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 2.17% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.17% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.63% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.63% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.63% |
Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 1.63% |
Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 1.63% |
Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.63% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.09% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.09% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.09% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.54% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.54% |
Hydrothermal Fe-Rich Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat | 0.54% |
Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 0.54% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.54% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.54% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.54% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.54% |
Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.54% |
Sediment | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Sediment | 0.54% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000119 | Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5m | Environmental | Open in IMG/M |
3300000120 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50m | Environmental | Open in IMG/M |
3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
3300000127 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45m | Environmental | Open in IMG/M |
3300000130 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50m | Environmental | Open in IMG/M |
3300000241 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m | Environmental | Open in IMG/M |
3300001390 | SMAR1 | Environmental | Open in IMG/M |
3300001750 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 | Environmental | Open in IMG/M |
3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
3300003885 | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 | Environmental | Open in IMG/M |
3300003886 | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 | Environmental | Open in IMG/M |
3300004030 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 | Environmental | Open in IMG/M |
3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
3300004056 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D1 | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300004147 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 | Environmental | Open in IMG/M |
3300004148 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
3300006465 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IX | Environmental | Open in IMG/M |
3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
3300007614 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG | Environmental | Open in IMG/M |
3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
3300007784 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG | Environmental | Open in IMG/M |
3300008464 | Deep sea sediment microbial communities from the Gulf of Mexico ? treatment with crude oil and Corexit | Engineered | Open in IMG/M |
3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
3300009102 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG | Environmental | Open in IMG/M |
3300009138 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG | Environmental | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300010234 | Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2 | Environmental | Open in IMG/M |
3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300011125 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, permeate | Environmental | Open in IMG/M |
3300011256 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, total | Environmental | Open in IMG/M |
3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
3300013315 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B | Engineered | Open in IMG/M |
3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
3300019750 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MG | Environmental | Open in IMG/M |
3300020234 | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N074 | Environmental | Open in IMG/M |
3300020235 | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N075 | Environmental | Open in IMG/M |
3300021514 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-30-0-1_MG | Environmental | Open in IMG/M |
3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
3300023368 | Hydrothermal Fe-rich mat microbial community from Snakepit Site, Mid-Atlantic Ridge, Atlantic Ocean - 667-BS4 | Environmental | Open in IMG/M |
3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
3300024338 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9 | Environmental | Open in IMG/M |
3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
3300025599 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025793 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
3300026131 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG (SPAdes) | Environmental | Open in IMG/M |
3300026135 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
3300027834 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes) | Environmental | Open in IMG/M |
3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
KGI_S1_ANT01_95mDRAFT_100122723 | 3300000119 | Marine | MSDDLQAQILKRQRAKAVRTAWVLGIIAVAIFATFVGSAIIGR* |
KGI_S1_ANT01_95mDRAFT_100215603 | 3300000119 | Marine | MSDDLQPQDLKHQRAKAVKTAWVLGIIAMAIFMVFIGSAVIGR* |
KGI_S1_ANT01_95mDRAFT_100744272 | 3300000119 | Marine | MSDDLQAQLLKRQRTKAVRTAWVLGIIAVAIFATFVGSAIIGR* |
SA_S2_NOR13_50mDRAFT_10052123 | 3300000120 | Marine | MNENHEPAELQRKRTNAVRTAWVLGIIAVAIFATFIGSAVIGR* |
BS_KBA_SWE12_21mDRAFT_100002295 | 3300000124 | Marine | MNENHQSDELLHKRANAVKTAWVLGIIALAIFATFIGSAVIGR* |
BS_KBA_SWE12_21mDRAFT_100260142 | 3300000124 | Marine | MNRIDESDELRRKRAQAVKTAWILGIIAVAIFATFIGSAVIGR* |
SA_S1_NOR05_45mDRAFT_100060404 | 3300000127 | Marine | MIRTMNENHEPAELQRKRTNAVRTAWVLGIIAVAIFATFIGSAVIGR* |
SA_S2_NOR15_50mDRAFT_100294683 | 3300000130 | Marine | MIDNHQPDELQRKRAQAVKTAWVLGIIAAAIFATFIGSAVIGR* |
SA_S2_NOR15_50mDRAFT_100346234 | 3300000130 | Marine | MSDELQAQILKRQRAQAVKTAWVLGIIAVAIFATFVGSAIIGR* |
SA_S2_NOR15_50mDRAFT_101291642 | 3300000130 | Marine | MNDNLQPQELQQKRARAVRTAWVLGFIAVAIFLTFIGSAVFGR* |
SA_S2_NOR15_50mDRAFT_101882322 | 3300000130 | Marine | MNENHESNELQHKRAQAVKTALVLGIIAVAIFATFIGSAIIGR* |
BS_KBA_SWE21_205mDRAFT_1000013319 | 3300000241 | Marine | MKENHQSDELLHKRANAVKTAWVLGIIALAIFATFIGSAVIGR* |
BS_KBA_SWE21_205mDRAFT_100904652 | 3300000241 | Marine | MNKINESDELRHKRAQAVKTAWILGIIAVAIFATFIGSAVIGR* |
SMAR1_1010002 | 3300001390 | Hydrothermal Vents | MMSDDPQSREQQRKQARAIKTAWVLGFIALAIFATFIGSAVMGH* |
JGI24023J19991_100788221 | 3300001750 | Marine | MSDILQSSELRRKRARAVRTAWILGLIAVAIFTTFIGSAIVGR |
KVRMV2_1000422927 | 3300002231 | Marine Sediment | MMTQDKHLDELRRKQAQAVKTAWVFGAIAVAIFVTFVGSAIIGH* |
Ga0063294_100381182 | 3300003885 | Hydrothermal Vents | MSDNLQAHEQQRKRAQAVKTAWLLGFIALAIFATFIGVAVIGR* |
Ga0063294_100571302 | 3300003885 | Hydrothermal Vents | MSNDLQSREQRRKQTQAVRTAWVLGFIALAIFAAFIGAAVVGR* |
Ga0063294_103735471 | 3300003885 | Hydrothermal Vents | MSDDLQSREQRRKRAQAVKTAWLLGFIALAIFATFIGVAVIGR* |
Ga0063293_1000160916 | 3300003886 | Hydrothermal Vents | MSDDLQLREQRRKRAQAVKTAWLLGFIALAIFATFIGAAVMRH* |
Ga0063293_101034602 | 3300003886 | Hydrothermal Vents | MMSDNPQSREQQRKQARAVKTAWVLGFIAVAIFATFIGAAVVGH* |
Ga0063293_102420491 | 3300003886 | Hydrothermal Vents | MSDDPQSREQQRKQARAIKTAWVLGFIALAIFATFIGSAVMGH* |
Ga0055444_100060792 | 3300004030 | Natural And Restored Wetlands | MDENHKPDQLRRQRAQAVKTAWVVGIIAILIFATFVGSAIIGH* |
Ga0055444_104367071 | 3300004030 | Natural And Restored Wetlands | TMINDHQTDELRHKRAQAVKTAWILGIIALAIFATFIGSAIIGR* |
Ga0055491_101092242 | 3300004050 | Natural And Restored Wetlands | MNQQRQMSEHSKSDQLGRQRAQAVKTAWILGIIAVLIFATFIGSAVIGR* |
Ga0055478_100033392 | 3300004056 | Natural And Restored Wetlands | MINDHQTDELRHKRAQAVKTAWILGIIALAIFATFIGSAIIGR* |
Ga0055478_100114703 | 3300004056 | Natural And Restored Wetlands | MNDYPDSEELRRKRAQAVRTAWILGIIAMSIFATFIGSAIIGH* |
Ga0055584_1008104162 | 3300004097 | Pelagic Marine | MNENHSPDDIQRRRASAVRTALILGIIALAIFATFIGSAIIGR* |
Ga0055584_1011633081 | 3300004097 | Pelagic Marine | MPMNPDNIQSNELKHKRAQAAKTALVLGMIALAIFATFIGSAIIGR* |
Ga0055584_1020606562 | 3300004097 | Pelagic Marine | MMIDKNSDELQNKRAQAVKTAWILGIIALAIFATFVGSAVLGR* |
Ga0055584_1024557612 | 3300004097 | Pelagic Marine | MTDKQQPDDIRVKRAQAVKTAWVLGIIALAIFATFIGSAVIGR* |
Ga0055584_1026518171 | 3300004097 | Pelagic Marine | MNEDFQKRELQQKRAKAVKTALVLGFIAVAIFVTFIGSAIFGR* |
Ga0055515_102444612 | 3300004147 | Natural And Restored Wetlands | MNDLSQSEELRRKRAQAVKTAWVLGIIAASIFAAFIGSAILGR* |
Ga0055515_102565181 | 3300004147 | Natural And Restored Wetlands | MNDQTESEELRRKRAQAVKTAWVLGTIALLIFATFIGSAIIGR* |
Ga0055521_102478962 | 3300004148 | Natural And Restored Wetlands | GLICDVTMNDYPDSEELRRKRAQAVRTAWILGIIAMSIFATFIGSAIIGH* |
Ga0070728_100514085 | 3300005588 | Marine Sediment | MNDDMQPTELKRKRAQAVRTAWVLGFIAVAIFTTFIISAVIGR* |
Ga0070727_100410285 | 3300005590 | Marine Sediment | LDDYVNDDTQSTELKRKRAQAVRTAWVLGFIAVAIFATFIISAVIGR* |
Ga0070727_106962681 | 3300005590 | Marine Sediment | MKNDNSQSNGLQQQRARAVKTALILGIIALAIFATFIGSAVIGR* |
Ga0070723_104074342 | 3300005612 | Marine Sediment | MNDDLQSHELQQKRARAVRTAWVLGFIAVAIFVTFIGSAIFGH* |
Ga0082250_108424492 | 3300006465 | Sediment | MNDDLQSQELQRKRVRAVKTAWILGFIAVAIFATFIGSAVMGR* |
Ga0099972_103866312 | 3300006467 | Marine | MIDKQSDDLQSKRAGAVKTAWVLGIIALAIFATFIGSAVLGR* |
Ga0099972_116432943 | 3300006467 | Marine | MVHNDISAHELQHKRARARRTAWILGLVALAIFATFIGSAVLGR* |
Ga0099972_125069822 | 3300006467 | Marine | MNDDLQPHELQQKRAKAVRTALILGFVALAIFVTFIGSAIFGR* |
Ga0099972_130134763 | 3300006467 | Marine | VNDDTQSTELKRKRAQAVRTAWVLGFIAVAIFATFIISAVIGR* |
Ga0102946_10004117 | 3300007614 | Soil | VLIKQIAIMNKDPDSDEIRQKRAQAVKTAWVLGIIALAIFATFIGSAVIGR* |
Ga0102946_10951622 | 3300007614 | Soil | MINDHQTDELRHKRAQAVKTAWILGIIALVIFATFIGSAIIGR* |
Ga0102954_10925272 | 3300007778 | Water | MVMQGDTQQRELQQKRANARRTAWVLGFIALAIFATFIGSAVIGR* |
Ga0102954_11212722 | 3300007778 | Water | MWTGTMIDKQDELQVKRAQAVKTAWVLGIIALAIFATFVGSAILGR* |
Ga0102955_10879231 | 3300007784 | Soil | MNDELQPHELQQKRARAVKTAWVLAFIAVAIFVTFIGSAIF |
Ga0115336_1096686 | 3300008464 | Sediment | MNGDIESQELQRKRARAVKTAWVLGFIAVAIFATFIGSAVIGR* |
Ga0102957_11238322 | 3300009027 | Pond Water | MIDNRPDEIKRKRAQAVKTALVLGFIALAIFATFVGSSVLGR* |
Ga0114950_100430384 | 3300009030 | Deep Subsurface | MSDDQQPQDLKRQRTQATRTAWVLGVIAMAIFAIFIGSAIIGR* |
Ga0114950_106018973 | 3300009030 | Deep Subsurface | MNDDLKSVELKRQRAQAVKTAWLLGIIALAIFGFFIGSAVIGR* |
Ga0102958_10607233 | 3300009035 | Soil | MIMQSDTQQRELQQKRANARRTAWVLGFIALAIFATFIGSAVMGR* |
Ga0105090_100077487 | 3300009075 | Freshwater Sediment | MNDHSKADQLSRQRAQATKTAWILGIIAGLIFLTFVVSAVIGR* |
Ga0102815_103227021 | 3300009080 | Estuarine | MNDNRQSDDLRQRRAHAVKTAWVLGIIAMAIFATFIGSAVIGR* |
Ga0102812_100195711 | 3300009086 | Estuarine | TMSNKTQPNESDRKRARAVKTAWVLGIIAMSIFATFIGSAIIGR* |
Ga0114948_102042532 | 3300009102 | Deep Subsurface | MNDDLKSVEIKRQRAQAVKTAWLLGIIALAIFGFFVGSAVIGH* |
Ga0102959_10764401 | 3300009138 | Soil | ELRRKRAQAVKTAWVLGTIALLIFATFIGSAIIGR* |
Ga0123573_100922775 | 3300009509 | Mangrove Sediment | MKQHSKSDQLNRQRAQAVKTAWVVGIIAILIFAAFIGSAVIGH* |
Ga0123573_109792982 | 3300009509 | Mangrove Sediment | MKEHPKSDQLSRQRAQAVKTAWVVGIIAVLIFAAFIGSAVIGH* |
Ga0123573_116597302 | 3300009509 | Mangrove Sediment | MKESSKSGQISRQRARAVKTAWILGIIAILIFATFIGSAVIGH* |
Ga0123573_118691232 | 3300009509 | Mangrove Sediment | DSKSDQLSRQRAQAVKTAWIVGIIAILIFAAFIGSAVIGH* |
Ga0136261_10483643 | 3300010234 | Freshwater | MEISMNDDTQSRELQERRAKAVKTALVLGFVALAIFVTFIGSAIFGR* |
Ga0118731_1008559535 | 3300010392 | Marine | MNNEPQSRELQQKRAAVRTALILGFVAMAIFATFIGAAVMGR* |
Ga0118731_1028582096 | 3300010392 | Marine | MNDNLQSHELQQKRARAVRTAWVLGFIAVAIFVTFIGSAIFGR* |
Ga0118731_1032251582 | 3300010392 | Marine | MWTETMIDNHNPDELRQKRAQAVKTAWILGIIAVAIFATFIGSAVIGR* |
Ga0118731_1085597832 | 3300010392 | Marine | MSNDLQSVELKRKRAQAVRTAWVLGFIAMAIFATFIISAVIGR* |
Ga0118731_1110149201 | 3300010392 | Marine | MRTGTMIDKQSDDLQSKRAGAVKTAWVLGIIALAIFATFI |
Ga0118731_1154616912 | 3300010392 | Marine | MMNENHESNELQHKRAQAVKTALVLGIIAAAIFATFIGSAIIGR* |
Ga0136852_103336243 | 3300010412 | Mangrove Sediment | MNEHPKPDQLSRQRAQAVKTAWIVGIIAILIFATFVGSAVIGH* |
Ga0118733_1000904405 | 3300010430 | Marine Sediment | MMIDKKSDELQHRRAQAVKTAWVLGIIAMAIFATFIGSAIIGR* |
Ga0118733_1001514996 | 3300010430 | Marine Sediment | MSNDLQSVELKRKRAQAVRTAWVLGFIAVAIFATFIISAVIGR* |
Ga0118733_1007659133 | 3300010430 | Marine Sediment | MNNDFQSCELQQKRARAVRTARVLGFIALVIFTTFIGSAVIGR* |
Ga0118733_1021307803 | 3300010430 | Marine Sediment | MNDNHQSSELRRKRAKAVKTAWILGFIALAIFVTFIGSAVIGR* |
Ga0118733_1027981742 | 3300010430 | Marine Sediment | MVDKQQPDEIRIKRARAVKTAWVLGIIALAIFATFIGSAVIGR* |
Ga0118733_1032335932 | 3300010430 | Marine Sediment | MNDDLQSHELQQKRARAVKTAWVLGFIAVAIFVTFIGSASFGR* |
Ga0118733_1057743481 | 3300010430 | Marine Sediment | KLQPREQQRKQAQAVKTAWVLGFIALAIFVTFIGAAVMGN* |
Ga0118733_1061008961 | 3300010430 | Marine Sediment | CGLNRIGTMIDNHQPDELQHKRAQAVKTAWVLGIIAMAIFATFIGSAIIGR* |
Ga0118733_1087602231 | 3300010430 | Marine Sediment | MKDDQQYSELRHKRSQAVKTACLLGIIAIAIFATFI |
Ga0151663_10729332 | 3300011125 | Marine | MSDNNPSNELQRKRAKAVKTAWILGIIALTIFATFIGSAVIGR* |
Ga0151664_10049172 | 3300011256 | Marine | MNDNPQSNELQRKRAKAVKTAWILGFIAVAIFATFIGSAVIGR* |
Ga0164320_101351072 | 3300013098 | Marine Sediment | MSDNLQSNELQHKRARAVKTAWVLGFIALTIFAAFIGAAVTGR* |
Ga0164320_103050692 | 3300013098 | Marine Sediment | MNGDLQSQELQRKRARAVKTAWILGFIAVAIFATFIGSAVMGR* |
Ga0164315_1000091819 | 3300013099 | Marine Sediment | MNNDPQANELKRKRAQAVRTAWVLGFIAVAIFVTFIGSAIFGR* |
Ga0164315_101292893 | 3300013099 | Marine Sediment | MQIKTTLMSDSHQPDELRRKRAQAVKTAWILGIIAIAIFASFIGSAVIGR* |
Ga0164315_106466682 | 3300013099 | Marine Sediment | MSDNLQASEQRKRAQAVKTAWVLGFIAFTIFAAFIGAAVTGR* |
Ga0164315_107021142 | 3300013099 | Marine Sediment | MIKGDHQSNEIRHKRTQAVKTAWVLGIIAVAIFASFIGAAVMRS* |
Ga0164315_112568182 | 3300013099 | Marine Sediment | MNNDQQSSELQRKQARAVKTAWILGFIATAIFATFIGSAVIGR* |
Ga0164313_100119922 | 3300013101 | Marine Sediment | MQIKTTPMSDSHQPDELRRKRAQAVKTAWILGIIAIAIFASFIGSAVIGR* |
Ga0164313_100248601 | 3300013101 | Marine Sediment | MNDKLQPREQKRKQAQAVKTAWVLGLIALAIFTTFIGAAML |
Ga0164313_105748152 | 3300013101 | Marine Sediment | MTDDLQRRKRARAVKTAWVLGLIAFTIFAVFIGAAVTGR* |
Ga0164313_107705702 | 3300013101 | Marine Sediment | MNDDSQANELKRKRARAVRTAWVLGFIAVAIFVTFIGSAIFGR* |
Ga0164313_108341841 | 3300013101 | Marine Sediment | MNKNHESNELQRKRAQAVKTALVLGMIAVAIFATFIGSAIIGR* |
Ga0164313_113437282 | 3300013101 | Marine Sediment | MSDNLQSSEQRKRAQAVKTAWVLGFIAFTIFAAFIGAAVTGR* |
Ga0173609_100983762 | 3300013315 | Sediment | MNDHSKSDQLSRQRAQAAKTAWILGIIAVLIFLTFIGSAVIGR* |
Ga0075346_10882201 | 3300014306 | Natural And Restored Wetlands | LSRQRAQAVKTAWILGIIAVLIFATFIGSAIIGR* |
Ga0194000_10203301 | 3300019750 | Sediment | NHQSEELRHKRARAVKTALVLGIIAVVIFATFIGSAIIGR |
Ga0212227_14511062 | 3300020234 | Sediment | MNDDLKSVEIKRQRAQAVKTAWLLGIIALAIFGFFIGSAVIGH |
Ga0212228_11393602 | 3300020235 | Sediment | MSDDQQPQDLKRQRTQATRTAWVLGVIAMAIFAIFIGSAIIGR |
Ga0212228_11972452 | 3300020235 | Sediment | MNDDLKSVELKRQRAQAVKTAWLLGIIALAIFGFFIGSAVIGR |
Ga0212228_13152304 | 3300020235 | Sediment | MSNDLQPQDLKRQRTQAVRTAWVLGIIAMAIFAIFIGSAIIGR |
Ga0190293_10004205 | 3300021514 | Hydrothermal Vent Microbial Mat | MNNDPQANELKRKRAQAVRTAWVLGFIAVAIFVTFIGSAIFGR |
Ga0190293_10017665 | 3300021514 | Hydrothermal Vent Microbial Mat | MNDDSQANELKRKRARAVRTAWVLGFIAVAIFVTFIGSAIFGR |
Ga0190293_10914331 | 3300021514 | Hydrothermal Vent Microbial Mat | MTDNLQLRETQRKRSQAVKTAWVLGFIAFGIFAVFIAAAVLGH |
Ga0224499_100054933 | 3300022206 | Sediment | MTDKQEPDDLRIKRAQAVKTAWVLGIIAIAIFATFIGSAVIGR |
Ga0224499_100365882 | 3300022206 | Sediment | MNENLKAEELRRKRAQAVKTAWVLGIIAVSIFATFIGSAIIGR |
Ga0224514_101537681 | 3300022217 | Sediment | MHSAARIKPDRTMTDKQEPDDLRIKRAQAVKTAWVLGIIAIAIFATFIGSAVIGR |
Ga0224514_101790842 | 3300022217 | Sediment | MEISMNDDTQSRELQQKRARAVKTALVLGFVALAIFVTFIGSAIIGR |
Ga0224502_102370241 | 3300022218 | Sediment | MSTEQQLHELQNRRSKAVKTALLLGFVALAIFAAFIGAAVM |
Ga0256753_10078422 | 3300023368 | Hydrothermal Fe-Rich Mat | MRDNLPTREQQRKQAQAVKTAWVLGFIALAVFATFIGAAAMRY |
(restricted) Ga0255040_100724702 | 3300024059 | Seawater | MIDKQQPDDIHIKRARAVKTAWVLGIIALAIFATFIGSAVIGR |
(restricted) Ga0255039_100389572 | 3300024062 | Seawater | MNDNHQSSELRRKRAQAVKTAWILGFIALAIFATFIGSAVIGR |
(restricted) Ga0255039_102096252 | 3300024062 | Seawater | MKNDNSQSNGLQQQRARAVKTALILGIIALAIFATFIGSAVIGR |
(restricted) Ga0255039_104124342 | 3300024062 | Seawater | MIDKQQPDDIRIKRARAVKTAWVLGIIALAIFATFIGSAVIGR |
(restricted) Ga0255043_103398851 | 3300024338 | Seawater | PCGLSVYITMNENRESNELQHKRARAVKTALVLGIIAVAIFATFIGSAIIGR |
(restricted) Ga0255042_102490241 | 3300024340 | Seawater | IRNKRDESMHDSQEMQQKRARAVRTALILGFIALAIFATFIGSAVMGR |
Ga0244777_106047941 | 3300024343 | Estuarine | MNDNRQSDDLRQRRAHAVKTAWVLGIIAMAIFATFIGSAVIGR |
(restricted) Ga0255049_100066392 | 3300024517 | Seawater | MSNDLQSDELRRRRGQAVRTAWILGFVALAIFAAFIGAAIVGR |
(restricted) Ga0255049_100858251 | 3300024517 | Seawater | MKVDQQSSELRHKRSQAVKTAWVLGIIAIAIFATFIGSAIIGR |
(restricted) Ga0255044_100879521 | 3300024529 | Seawater | MKENHQSNELRHKRAQAVKTAWILGIIAVAIFATF |
(restricted) Ga0255044_101085192 | 3300024529 | Seawater | MNDNLQSQELQQKRARAVRTAWLLGFIAVAIFLTFIGSAVLGR |
Ga0210074_10009208 | 3300025599 | Natural And Restored Wetlands | VRIETGRAMDENQKPDQLRRQRAQAVKTAWVVGIIAILIFATFVGSAIIGH |
Ga0210065_10076063 | 3300025793 | Natural And Restored Wetlands | MINDHQTDELRHKRAQAVKTAWILGIIALAIFATFIGSAIIGR |
Ga0209456_100979153 | 3300025883 | Pelagic Marine | MIDKHQPDDLRQKRAQAVKTAWVLGIIAVAIFATFIGSAIIGR |
Ga0209928_10435471 | 3300026131 | Soil | ELRRKRAQAVKTAWVLGTIALLIFATFIGSAIIGR |
Ga0209939_10376132 | 3300026135 | Soil | MINDHQTDELRHKRAQAVKTAWILGIIALVIFATFIGSAIIGR |
Ga0209392_10005058 | 3300027683 | Freshwater Sediment | MNDHSKADQLSRQRAQATKTAWILGIIAGLIFLTFVVSAVIGR |
Ga0209578_100677842 | 3300027820 | Marine Sediment | VNDDTQSTELKRKRAQAVRTAWVLGFIAVAIFATFIISAVIGR |
Ga0209692_101271542 | 3300027828 | Marine Sediment | MNDDMQPTELKRKRAQAVRTAWVLGFIAVAIFTTFIISAVIGR |
Ga0209344_100270714 | 3300027834 | Marine | MTDDLQQRKRARALKTAWILGIIAFTIFAVFIGAAVTGR |
(restricted) Ga0255041_101771842 | 3300027837 | Seawater | DNHQSSELRRKRAQAVKTAWILGFIAIAIFATFIGSAVIGR |
(restricted) Ga0255041_102606382 | 3300027837 | Seawater | MTDKQQPDDIHIKRAQAVKTAWVLGIIALAIFATFIGSAVIGR |
(restricted) Ga0255041_103303662 | 3300027837 | Seawater | MSDNHQSSEPQRKRAKAVKTAWILGFIAVAIFATFIGSA |
(restricted) Ga0255041_103667752 | 3300027837 | Seawater | MNKNHQSSELQHKRAKAVKTALVLGAIAVAIFATFIGSAIIGR |
Ga0209271_101115561 | 3300027845 | Marine Sediment | DELRQKRAQAVKTAWILGIIAVAIFATFIGSAVIGR |
Ga0209013_102235902 | 3300027858 | Marine | MNNEIQPADLKRQRAKAVRTALVLGVIAVTIFAIFIGSAVVGR |
(restricted) Ga0233415_102930802 | 3300027861 | Seawater | MQSHELQQKRARAVRTAWLLGFVALAIFATFIGSAIVGR |
Ga0265306_100673963 | 3300028598 | Sediment | MIDKHEPDELRQKRAQAVKTALVLGIIAAAIFATFVGSAIIGR |
Ga0265306_106596212 | 3300028598 | Sediment | MIDKHQLDELQHKRAQAVKTAWVLGIIAMAIFATFIGSAIIGR |
Ga0265309_105445471 | 3300028599 | Sediment | ETKAMNDYLKSEELRRKRARAVKTAWILGIIAVSIFATFIGSAIIGR |
Ga0316575_101117353 | 3300031665 | Rhizosphere | MKDNSKSDQINRQRAQAVKTAWIVGIIAILIFATFIGSAVIGH |
Ga0316576_101565942 | 3300031727 | Rhizosphere | MKDNSKSDQLNRQRAQAVKTAWIVGIIAILIFATFIGSAVIGH |
Ga0326597_105577432 | 3300031965 | Soil | MSDHSKPDLISRQRAQAVKTAWVLGIIALVIFATFVGSAVIGR |
Ga0316201_100009728 | 3300032136 | Worm Burrow | MKDHPKSDELRRKRTQAVKTAWVLGIIAFLIFATFIGSAIIGR |
Ga0316201_1000186510 | 3300032136 | Worm Burrow | MNENQRSDELQHKRSNAVRTAWVLGIIAMAIFATFIGSAIIGR |
Ga0316201_100050949 | 3300032136 | Worm Burrow | MKGSDQSDELRHKRAQAVKTAVVLGVIALAIFAAFIGSAIIGR |
Ga0316201_100390647 | 3300032136 | Worm Burrow | MVKHEHQSDEIQQKRARAVKTAWVLGIIAMAIFATFIGSAVIGR |
Ga0316201_100580923 | 3300032136 | Worm Burrow | MNTMDENHRSDELQHKRANAVKTAWILGIIAMAIFATFIGSAVIGR |
Ga0316201_101905752 | 3300032136 | Worm Burrow | MIDNHQPDELRQKRARAAKTALVLGIIALAIFATFIGSAVIGR |
Ga0316201_102290812 | 3300032136 | Worm Burrow | MKDADQPDDLRHKRAQAVKTAVVLGIIALAIFAAFIGSAVIGR |
Ga0316201_102980093 | 3300032136 | Worm Burrow | MKDNQYTDELRTKRAQAVKTALVLGIIAVAIFAAFIASAIIGR |
Ga0316201_104522782 | 3300032136 | Worm Burrow | MDKEHQAEELRQRRAQAVKTAWVLGLIALAIFATFIGSAVIGR |
Ga0316201_106157702 | 3300032136 | Worm Burrow | MIDKQSDELKAKRTQAVKTAWVLGIIALAIFATFVGSAVLGR |
Ga0316593_100280092 | 3300032168 | Rhizosphere | MMRENSKSDQLSRQRAQAVKTAWIVGIIAILIFATFIGSAVIGH |
Ga0316187_1000016723 | 3300032231 | Worm Burrow | MTDKQQPDDIRIKRARAVKTAWVLGIIALAIFATFIGSAVIGR |
Ga0316187_101359032 | 3300032231 | Worm Burrow | MNENHESSELQHKRARAVKTALVLGMIAVAIFATFIGSAIIGR |
Ga0316187_101420182 | 3300032231 | Worm Burrow | MNDNLQPHELQQKRARAVKTAWVLGFIAVAIFATFIGSAIIGR |
Ga0316187_101656902 | 3300032231 | Worm Burrow | MNNDLQSVELKQKRAQAVRTALVLGFIALAIFAAFIISAVIGR |
Ga0316187_102078852 | 3300032231 | Worm Burrow | MNKDHQSDEVRNKRAKAVKTAWVLGVIAVAIFATFIGSAIIGR |
Ga0316187_103132901 | 3300032231 | Worm Burrow | MIEKNSDELQNKRAQAVKTAWVLGIIALAIFATFVGSAILG |
Ga0316187_108763452 | 3300032231 | Worm Burrow | MTDKQQPDDIRIKRARAVKTAWVLGIIALAIFVTFIGSAVIGR |
Ga0316198_101414112 | 3300032251 | Sediment | MMIERNSDELQNKRAQAVKTAWVLGIIALAIFATFVGSAILGR |
Ga0316198_107263011 | 3300032251 | Sediment | MIDNRPDEIKRKRAQAVKTALVLGFIALAIFATFV |
Ga0316196_104180681 | 3300032252 | Sediment | NHESEELRHKRAQAVKTALVLGIIAIAIFATFIGSAVVGR |
Ga0316191_101231982 | 3300032258 | Worm Burrow | MIDDHQPDELQRKRAQAVKTAWVLGIIAMAIFATFIGSAIIGR |
Ga0316191_102330562 | 3300032258 | Worm Burrow | MNEDFQKRELQQKRAKAVKTALVLGFIAVAIFVTFIGSAIFGR |
Ga0316190_101141193 | 3300032259 | Worm Burrow | LNWTGTMIDDHQPDELQRKRAQAVKTAWVLGIIAMAIFATFIGSAIIGR |
Ga0316192_102083532 | 3300032260 | Worm Burrow | MIEKNSDELQNKRAQAVKTAWVLGIIALAIFATFVGSAILGR |
Ga0316192_107526331 | 3300032260 | Worm Burrow | MMIDDYQADELKHKRAQAVKTAWVLGIIAMAIFATFIGSAIIGR |
Ga0316192_108664561 | 3300032260 | Worm Burrow | MHSVERIEPMIDNRQADEIQHKRAQAVKTAWVLGIIAMAIFATFIGSAIIGR |
Ga0316192_109799032 | 3300032260 | Worm Burrow | QSVELKQKRAQAVRTALVLGFIALAIFAAFIISAVIGR |
Ga0316194_100964112 | 3300032262 | Sediment | MMIEKNSDELQNKRAQAVKTAWVLGIIALAIFATFVGSAILGR |
Ga0316195_100582202 | 3300032263 | Sediment | MNDDVQSHELQQKRARAVRTAWVLGFIAVAIFVTFIGSAIFGR |
Ga0316195_103473022 | 3300032263 | Sediment | MNENHRPDDLQHKRANAVKTAWVLGIIAAAIFATFIGSAIIGR |
Ga0316195_104661601 | 3300032263 | Sediment | PQYAQPRGMIQSRNMNDQSKSDQLSRQRAQAVKTAWIVGIIAVLIFATFIGSAVIGR |
Ga0316188_100023195 | 3300032276 | Worm Burrow | MMIDKQSDELQHKRAQAVKTAWVLGIIAMAIFATFIGSAVIGR |
Ga0316193_100431093 | 3300033429 | Sediment | MNENHESNELQHKRARAVKTALVLGIIAVAIFATFIGSAIIGR |
Ga0316193_103385651 | 3300033429 | Sediment | MNDNLQPHELQQKRARAVKTAWVLGFIAVAIFATF |
Ga0316193_104026903 | 3300033429 | Sediment | MDENHSPSELQRKRARAVKTAWVLAIIAVAIFATFIGSAVIGH |
Ga0316193_109378321 | 3300033429 | Sediment | LNEDFKKRELQQKRAKAVKTALVLGFIAVAIFVTFIGSAIFGR |
Ga0316193_113301372 | 3300033429 | Sediment | TGSDLQRTQSCGLNWIRSMNENHSPDDIQRRRASAVRTALILGIIALAIFATFIGSAIIG |
Ga0316621_104213002 | 3300033488 | Soil | MNDHSKSDQLSRQRAQAARTAWILGIIAVLIFVTFIGSAVIGR |
Ga0316596_12234892 | 3300033541 | Rhizosphere | MKDNSKSDQLNLQRAQAVKTEWIVGIIAILIFATFIGSAVIGH |
⦗Top⦘ |