NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F013645

Metagenome / Metatranscriptome Family F013645

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013645
Family Type Metagenome / Metatranscriptome
Number of Sequences 269
Average Sequence Length 52 residues
Representative Sequence EVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Number of Associated Samples 246
Number of Associated Scaffolds 269

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 34.33 %
% of genes near scaffold ends (potentially truncated) 42.38 %
% of genes from short scaffolds (< 2000 bps) 97.40 %
Associated GOLD sequencing projects 239
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.398 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(21.561 % of family members)
Environment Ontology (ENVO) Unclassified
(43.494 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(65.799 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.46%    β-sheet: 0.00%    Coil/Unstructured: 76.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 269 Family Scaffolds
PF00033Cytochrome_B 13.38
PF13631Cytochrom_B_N_2 2.23
PF00510COX3 1.49
PF00115COX1 1.49
PF00032Cytochrom_B_C 0.37
PF11680DUF3276 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 269 Family Scaffolds
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 13.75
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 1.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.26 %
UnclassifiedrootN/A0.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000126|BS_KBB_SWE26_205mDRAFT_c1060964All Organisms → cellular organisms → Eukaryota → Sar597Open in IMG/M
3300000385|PR_CR_10_Liq_1_inCRDRAFT_1026279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1380Open in IMG/M
3300000418|P_2C_Liq_1_UnCtyDRAFT_1072580All Organisms → cellular organisms → Eukaryota → Sar571Open in IMG/M
3300002154|JGI24538J26636_10062437All Organisms → cellular organisms → Eukaryota → Sar894Open in IMG/M
3300003292|Ga0006242J48907_102355All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Francisellaceae → Francisella → Francisella persica512Open in IMG/M
3300003292|Ga0006242J48907_106777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae983Open in IMG/M
3300003554|Ga0008451J51688_101671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae595Open in IMG/M
3300003684|Ga0005851_1035881All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300003860|Ga0031658_1061331All Organisms → cellular organisms → Eukaryota → Sar656Open in IMG/M
3300004639|Ga0066620_1240968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae632Open in IMG/M
3300004764|Ga0007754_1041008All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300004769|Ga0007748_10092438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae734Open in IMG/M
3300004769|Ga0007748_10139872All Organisms → cellular organisms → Bacteria → Proteobacteria1520Open in IMG/M
3300004792|Ga0007761_10054968All Organisms → cellular organisms → Eukaryota → Sar679Open in IMG/M
3300004792|Ga0007761_10128127All Organisms → cellular organisms → Eukaryota → Sar505Open in IMG/M
3300004795|Ga0007756_10061386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1676Open in IMG/M
3300004804|Ga0007796_10162442All Organisms → cellular organisms → Eukaryota → Sar666Open in IMG/M
3300004806|Ga0007854_10359904All Organisms → cellular organisms → Eukaryota → Sar596Open in IMG/M
3300005583|Ga0049085_10058872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1369Open in IMG/M
3300005595|Ga0066833_10166998All Organisms → cellular organisms → Eukaryota → Sar604Open in IMG/M
3300005596|Ga0066834_10212897All Organisms → cellular organisms → Eukaryota → Sar612Open in IMG/M
3300006128|Ga0007828_1105917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae580Open in IMG/M
3300006129|Ga0007834_1135952All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Francisellaceae → Francisella → Francisella persica501Open in IMG/M
3300006355|Ga0075501_1069591All Organisms → cellular organisms → Eukaryota → Sar566Open in IMG/M
3300006379|Ga0075513_1027672All Organisms → cellular organisms → Eukaryota → Sar795Open in IMG/M
3300006379|Ga0075513_1090144All Organisms → cellular organisms → Eukaryota → Sar528Open in IMG/M
3300006382|Ga0075494_1000205All Organisms → cellular organisms → Eukaryota → Sar502Open in IMG/M
3300006397|Ga0075488_1091064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae590Open in IMG/M
3300006401|Ga0075506_1106897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae803Open in IMG/M
3300006403|Ga0075514_1224224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae816Open in IMG/M
3300006641|Ga0075471_10389016All Organisms → cellular organisms → Eukaryota → Sar700Open in IMG/M
3300006714|Ga0079246_1270954All Organisms → cellular organisms → Eukaryota → Sar551Open in IMG/M
3300006917|Ga0075472_10501987All Organisms → cellular organisms → Eukaryota → Sar604Open in IMG/M
3300007213|Ga0079255_1259817All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300007522|Ga0105053_10494550All Organisms → cellular organisms → Eukaryota → Sar1000Open in IMG/M
3300007552|Ga0102818_1092892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae598Open in IMG/M
3300007608|Ga0102800_1267811All Organisms → cellular organisms → Eukaryota → Sar614Open in IMG/M
3300007655|Ga0102825_1055803All Organisms → cellular organisms → Eukaryota → Sar804Open in IMG/M
3300007861|Ga0105736_1047126All Organisms → cellular organisms → Eukaryota → Sar858Open in IMG/M
3300007955|Ga0105740_1049752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae661Open in IMG/M
3300008013|Ga0099809_10034721All Organisms → cellular organisms → Eukaryota → Sar741Open in IMG/M
3300008030|Ga0099821_1005194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1264Open in IMG/M
3300008673|Ga0103941_10739All Organisms → cellular organisms → Eukaryota → Sar674Open in IMG/M
3300008689|Ga0103948_10699All Organisms → cellular organisms → Eukaryota → Sar633Open in IMG/M
3300008834|Ga0103882_10023675All Organisms → cellular organisms → Eukaryota → Sar784Open in IMG/M
3300008834|Ga0103882_10029696All Organisms → cellular organisms → Eukaryota → Sar737Open in IMG/M
3300008834|Ga0103882_10046279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae647Open in IMG/M
3300008834|Ga0103882_10056538All Organisms → cellular organisms → Eukaryota → Sar608Open in IMG/M
3300008834|Ga0103882_10071143All Organisms → cellular organisms → Eukaryota → Sar564Open in IMG/M
3300008921|Ga0103486_1011455All Organisms → cellular organisms → Eukaryota → Sar563Open in IMG/M
3300008930|Ga0103733_1062520All Organisms → cellular organisms → Eukaryota → Sar590Open in IMG/M
3300008931|Ga0103734_1053811All Organisms → cellular organisms → Eukaryota → Sar614Open in IMG/M
3300008931|Ga0103734_1057325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae595Open in IMG/M
3300008934|Ga0103737_1011155All Organisms → cellular organisms → Eukaryota → Sar1054Open in IMG/M
3300008936|Ga0103739_1045840All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia multistriata611Open in IMG/M
3300008953|Ga0104241_1010495All Organisms → cellular organisms → Eukaryota → Sar634Open in IMG/M
3300008998|Ga0103502_10187281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales755Open in IMG/M
3300009006|Ga0103710_10089841All Organisms → cellular organisms → Eukaryota → Sar752Open in IMG/M
3300009006|Ga0103710_10127514All Organisms → cellular organisms → Eukaryota → Sar654Open in IMG/M
3300009024|Ga0102811_1167424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae822Open in IMG/M
3300009052|Ga0102886_1244567All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300009061|Ga0102938_10515487All Organisms → cellular organisms → Eukaryota → Sar605Open in IMG/M
3300009068|Ga0114973_10340287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae794Open in IMG/M
3300009068|Ga0114973_10496316All Organisms → cellular organisms → Eukaryota → Sar632Open in IMG/M
3300009079|Ga0102814_10446466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae704Open in IMG/M
3300009086|Ga0102812_10284556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae899Open in IMG/M
3300009129|Ga0118728_1119208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium1181Open in IMG/M
3300009184|Ga0114976_10342963All Organisms → cellular organisms → Eukaryota → Sar791Open in IMG/M
3300009216|Ga0103842_1036317All Organisms → cellular organisms → Eukaryota → Sar572Open in IMG/M
3300009218|Ga0103848_1024901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1127Open in IMG/M
3300009225|Ga0103851_1025318All Organisms → cellular organisms → Eukaryota → Sar924Open in IMG/M
3300009228|Ga0103854_1003388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1455Open in IMG/M
3300009247|Ga0103861_10010707All Organisms → cellular organisms → Eukaryota → Sar1152Open in IMG/M
3300009247|Ga0103861_10022708All Organisms → cellular organisms → Eukaryota → Sar863Open in IMG/M
3300009254|Ga0103867_1017673All Organisms → cellular organisms → Eukaryota → Sar710Open in IMG/M
3300009265|Ga0103873_1026113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1008Open in IMG/M
3300009268|Ga0103874_1005326All Organisms → cellular organisms → Eukaryota → Sar836Open in IMG/M
3300009269|Ga0103876_1076996All Organisms → cellular organisms → Eukaryota → Sar510Open in IMG/M
3300009272|Ga0103877_1014531All Organisms → cellular organisms → Eukaryota → Sar560Open in IMG/M
3300009333|Ga0103833_1003117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae603Open in IMG/M
3300009340|Ga0103838_1005046All Organisms → cellular organisms → Eukaryota → Sar605Open in IMG/M
3300009344|Ga0103834_1006570All Organisms → cellular organisms → Eukaryota → Sar609Open in IMG/M
3300009353|Ga0103847_1000336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1555Open in IMG/M
3300009370|Ga0118716_1116006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1372Open in IMG/M
3300009385|Ga0103852_1000940All Organisms → cellular organisms → Eukaryota → Sar2206Open in IMG/M
3300009402|Ga0103742_1005592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1323Open in IMG/M
3300009436|Ga0115008_10593040All Organisms → cellular organisms → Eukaryota → Sar797Open in IMG/M
3300009516|Ga0129359_1013814All Organisms → cellular organisms → Eukaryota → Sar636Open in IMG/M
3300009529|Ga0114919_10280677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1172Open in IMG/M
3300009537|Ga0129283_10481280All Organisms → cellular organisms → Eukaryota → Sar537Open in IMG/M
3300009543|Ga0115099_10817206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae587Open in IMG/M
3300009544|Ga0115006_10075900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae2959Open in IMG/M
3300009544|Ga0115006_11376333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae635Open in IMG/M
3300009544|Ga0115006_11918014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae544Open in IMG/M
3300009550|Ga0115013_10586427All Organisms → cellular organisms → Eukaryota → Sar741Open in IMG/M
3300009592|Ga0115101_1237236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae660Open in IMG/M
3300009592|Ga0115101_1255628All Organisms → cellular organisms → Eukaryota → Sar684Open in IMG/M
3300009593|Ga0115011_10965680All Organisms → cellular organisms → Eukaryota → Sar718Open in IMG/M
3300009608|Ga0115100_11151325All Organisms → cellular organisms → Eukaryota → Sar525Open in IMG/M
3300009722|Ga0123378_116264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae578Open in IMG/M
3300009735|Ga0123377_1058431All Organisms → cellular organisms → Eukaryota → Sar527Open in IMG/M
3300009747|Ga0123363_1036263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae520Open in IMG/M
3300009756|Ga0123366_1029849All Organisms → cellular organisms → Eukaryota → Sar618Open in IMG/M
3300009785|Ga0115001_10649732All Organisms → cellular organisms → Eukaryota → Sar642Open in IMG/M
3300009864|Ga0132193_104867All Organisms → cellular organisms → Eukaryota → Sar728Open in IMG/M
3300010007|Ga0133909_100037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae2041Open in IMG/M
3300010018|Ga0133896_1000004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae11552Open in IMG/M
3300010031|Ga0126337_10559172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae573Open in IMG/M
3300010129|Ga0123376_1113880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae507Open in IMG/M
3300010135|Ga0123382_1165333All Organisms → cellular organisms → Eukaryota → Sar614Open in IMG/M
3300010430|Ga0118733_107864037All Organisms → cellular organisms → Eukaryota → Sar552Open in IMG/M
3300010885|Ga0133913_13611869All Organisms → cellular organisms → Eukaryota → Sar1004Open in IMG/M
3300010981|Ga0138316_10786107All Organisms → cellular organisms → Eukaryota → Sar511Open in IMG/M
3300012370|Ga0123369_1095049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae514Open in IMG/M
3300012408|Ga0138265_1413326All Organisms → cellular organisms → Eukaryota → Sar589Open in IMG/M
3300012414|Ga0138264_1724658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae539Open in IMG/M
3300012414|Ga0138264_1796563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae504Open in IMG/M
3300012516|Ga0129325_1144781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1107Open in IMG/M
3300012518|Ga0129349_1237126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae825Open in IMG/M
3300012528|Ga0129352_10034318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae759Open in IMG/M
3300012687|Ga0157543_1186512All Organisms → cellular organisms → Eukaryota → Sar575Open in IMG/M
3300012688|Ga0157541_1144174All Organisms → cellular organisms → Eukaryota → Sar598Open in IMG/M
3300012710|Ga0157550_1166693All Organisms → cellular organisms → Eukaryota → Sar612Open in IMG/M
3300012732|Ga0157549_1175204All Organisms → cellular organisms → Eukaryota → Sar547Open in IMG/M
3300012742|Ga0157539_160631All Organisms → cellular organisms → Eukaryota → Sar783Open in IMG/M
3300012765|Ga0138274_1167971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae714Open in IMG/M
3300012771|Ga0138270_1192400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae668Open in IMG/M
3300012771|Ga0138270_1287837All Organisms → cellular organisms → Eukaryota → Sar569Open in IMG/M
3300012775|Ga0138280_1219972All Organisms → cellular organisms → Eukaryota → Sar525Open in IMG/M
3300012785|Ga0157528_123430All Organisms → cellular organisms → Eukaryota → Sar622Open in IMG/M
3300012786|Ga0157527_180486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae529Open in IMG/M
3300012953|Ga0163179_12061417All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300012966|Ga0129341_1147746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae507Open in IMG/M
3300012966|Ga0129341_1306347All Organisms → cellular organisms → Eukaryota → Sar502Open in IMG/M
(restricted) 3300013123|Ga0172368_10328163All Organisms → cellular organisms → Eukaryota → Sar714Open in IMG/M
(restricted) 3300013131|Ga0172373_10630990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae638Open in IMG/M
3300013295|Ga0170791_15960801All Organisms → cellular organisms → Eukaryota → Sar744Open in IMG/M
3300016696|Ga0180049_1117596All Organisms → cellular organisms → Eukaryota → Sar1416Open in IMG/M
3300017503|Ga0186372_1049502All Organisms → cellular organisms → Eukaryota → Sar645Open in IMG/M
3300017768|Ga0187220_1135271All Organisms → cellular organisms → Eukaryota → Sar745Open in IMG/M
3300017956|Ga0181580_10728405All Organisms → cellular organisms → Eukaryota → Sar629Open in IMG/M
3300017989|Ga0180432_11214888All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300017990|Ga0180436_11578704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae507Open in IMG/M
3300018065|Ga0180430_10729382All Organisms → cellular organisms → Eukaryota → Sar686Open in IMG/M
3300018574|Ga0188842_1004318All Organisms → cellular organisms → Eukaryota → Sar838Open in IMG/M
3300018575|Ga0193474_1012455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae647Open in IMG/M
3300018592|Ga0193113_1025355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae623Open in IMG/M
3300018602|Ga0193182_1016472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae667Open in IMG/M
3300018610|Ga0188884_1005737All Organisms → cellular organisms → Eukaryota → Sar844Open in IMG/M
3300018637|Ga0192914_1019143All Organisms → cellular organisms → Eukaryota → Sar536Open in IMG/M
3300018648|Ga0193445_1030833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae696Open in IMG/M
3300018659|Ga0193067_1054997All Organisms → cellular organisms → Eukaryota → Sar581Open in IMG/M
3300018660|Ga0193130_1015404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae935Open in IMG/M
3300018662|Ga0192848_1027032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae674Open in IMG/M
3300018666|Ga0193159_1052598All Organisms → cellular organisms → Eukaryota → Sar516Open in IMG/M
3300018667|Ga0193127_1024179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae681Open in IMG/M
3300018696|Ga0193110_1023152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae686Open in IMG/M
3300018713|Ga0192887_1032721All Organisms → cellular organisms → Eukaryota → Sar687Open in IMG/M
3300018745|Ga0193000_1064090All Organisms → cellular organisms → Eukaryota → Sar543Open in IMG/M
3300018791|Ga0192950_1070924All Organisms → cellular organisms → Eukaryota → Sar524Open in IMG/M
3300018811|Ga0193183_1061515All Organisms → cellular organisms → Eukaryota → Sar672Open in IMG/M
3300018824|Ga0188874_1015528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae832Open in IMG/M
3300018825|Ga0193048_1063237All Organisms → cellular organisms → Eukaryota → Sar560Open in IMG/M
3300018834|Ga0192877_1060952All Organisms → cellular organisms → Eukaryota → Sar1121Open in IMG/M
3300018840|Ga0193200_1087146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1229Open in IMG/M
3300018844|Ga0193312_1009790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1025Open in IMG/M
3300018846|Ga0193253_1089741All Organisms → cellular organisms → Eukaryota → Sar729Open in IMG/M
3300018853|Ga0192958_1107741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae666Open in IMG/M
3300018873|Ga0193553_1129157All Organisms → cellular organisms → Eukaryota → Sar604Open in IMG/M
3300018901|Ga0193203_10072283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1106Open in IMG/M
3300018901|Ga0193203_10223058All Organisms → cellular organisms → Eukaryota → Sar617Open in IMG/M
3300018912|Ga0193176_10119533All Organisms → cellular organisms → Eukaryota → Sar716Open in IMG/M
3300018912|Ga0193176_10239800All Organisms → cellular organisms → Eukaryota → Sar517Open in IMG/M
3300018930|Ga0192955_10138428All Organisms → cellular organisms → Eukaryota → Sar622Open in IMG/M
3300018940|Ga0192818_10191039All Organisms → cellular organisms → Eukaryota → Sar572Open in IMG/M
3300018945|Ga0193287_1119897All Organisms → cellular organisms → Eukaryota → Sar556Open in IMG/M
3300018960|Ga0192930_10041677All Organisms → cellular organisms → Eukaryota → Sar1793Open in IMG/M
3300018961|Ga0193531_10105651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1107Open in IMG/M
3300018966|Ga0193293_10025968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae865Open in IMG/M
3300018979|Ga0193540_10217893All Organisms → cellular organisms → Eukaryota → Sar520Open in IMG/M
3300018980|Ga0192961_10157894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae689Open in IMG/M
3300018983|Ga0193017_10263464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae524Open in IMG/M
3300018986|Ga0193554_10061628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1130Open in IMG/M
3300018988|Ga0193275_10254130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae552Open in IMG/M
3300018989|Ga0193030_10132170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae796Open in IMG/M
3300019001|Ga0193034_10200426All Organisms → cellular organisms → Eukaryota → Sar501Open in IMG/M
3300019021|Ga0192982_10226846All Organisms → cellular organisms → Eukaryota → Sar668Open in IMG/M
3300019022|Ga0192951_10148344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae824Open in IMG/M
3300019031|Ga0193516_10136527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae831Open in IMG/M
3300019032|Ga0192869_10294559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae707Open in IMG/M
3300019039|Ga0193123_10304461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae625Open in IMG/M
3300019075|Ga0193452_107425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae709Open in IMG/M
3300019100|Ga0193045_1064089All Organisms → cellular organisms → Eukaryota → Sar572Open in IMG/M
3300019104|Ga0193177_1006649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1046Open in IMG/M
3300019126|Ga0193144_1010389All Organisms → cellular organisms → Eukaryota → Sar1109Open in IMG/M
3300019136|Ga0193112_1083587All Organisms → cellular organisms → Eukaryota → Sar754Open in IMG/M
3300019824|Ga0197830_106168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae523Open in IMG/M
3300020240|Ga0211494_1071110Not Available684Open in IMG/M
3300020338|Ga0211571_1115987All Organisms → cellular organisms → Eukaryota → Sar610Open in IMG/M
3300020392|Ga0211666_10335866All Organisms → cellular organisms → Eukaryota → Sar561Open in IMG/M
3300021169|Ga0206687_1752803All Organisms → cellular organisms → Eukaryota → Sar613Open in IMG/M
3300021296|Ga0210300_133152All Organisms → cellular organisms → Eukaryota → Sar612Open in IMG/M
3300021323|Ga0210295_1017047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae665Open in IMG/M
3300021925|Ga0063096_1037842All Organisms → cellular organisms → Eukaryota → Sar560Open in IMG/M
3300021961|Ga0222714_10560503All Organisms → cellular organisms → Eukaryota → Sar577Open in IMG/M
3300022375|Ga0210313_1038603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae570Open in IMG/M
3300023230|Ga0222709_1035664All Organisms → cellular organisms → Eukaryota → Sar643Open in IMG/M
(restricted) 3300024252|Ga0233435_1023300All Organisms → cellular organisms → Eukaryota2879Open in IMG/M
3300024334|Ga0228671_1161493All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300024534|Ga0256357_1035801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae968Open in IMG/M
3300024851|Ga0255293_1100203All Organisms → cellular organisms → Eukaryota → Sar535Open in IMG/M
3300025138|Ga0209634_1308608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae540Open in IMG/M
3300026197|Ga0209925_1201028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae582Open in IMG/M
3300026403|Ga0247557_1045850All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300026423|Ga0247580_1083655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae617Open in IMG/M
3300026426|Ga0247570_1080096All Organisms → cellular organisms → Eukaryota → Sar640Open in IMG/M
3300026427|Ga0247556_1047903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae960Open in IMG/M
3300026437|Ga0247577_1090210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae625Open in IMG/M
3300026500|Ga0247592_1106017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae677Open in IMG/M
3300026513|Ga0247590_1178601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae541Open in IMG/M
3300027188|Ga0208921_1041525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae681Open in IMG/M
3300027264|Ga0255580_1106771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae775Open in IMG/M
3300027264|Ga0255580_1114234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae738Open in IMG/M
3300027714|Ga0209815_1244948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae542Open in IMG/M
(restricted) 3300027728|Ga0247836_1237126All Organisms → cellular organisms → Eukaryota → Sar694Open in IMG/M
3300027736|Ga0209190_1151110All Organisms → cellular organisms → Eukaryota → Sar1006Open in IMG/M
3300027793|Ga0209972_10214258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae885Open in IMG/M
3300027810|Ga0209302_10231778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae874Open in IMG/M
3300027833|Ga0209092_10603152All Organisms → cellular organisms → Eukaryota → Sar549Open in IMG/M
3300027849|Ga0209712_10763443All Organisms → cellular organisms → Eukaryota → Sar530Open in IMG/M
(restricted) 3300027861|Ga0233415_10501125All Organisms → cellular organisms → Eukaryota → Sar587Open in IMG/M
3300027883|Ga0209713_10017602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae4809Open in IMG/M
3300027896|Ga0209777_10574888All Organisms → cellular organisms → Eukaryota → Sar819Open in IMG/M
3300028109|Ga0247582_1036887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1262Open in IMG/M
3300028109|Ga0247582_1107200All Organisms → cellular organisms → Eukaryota → Sar728Open in IMG/M
3300028131|Ga0228642_1106673All Organisms → cellular organisms → Eukaryota → Sar699Open in IMG/M
3300028337|Ga0247579_1025900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1201Open in IMG/M
3300028575|Ga0304731_11288260All Organisms → cellular organisms → Eukaryota → Sar511Open in IMG/M
3300028599|Ga0265309_10717532All Organisms → cellular organisms → Eukaryota → Sar679Open in IMG/M
3300030924|Ga0138348_1570869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae583Open in IMG/M
3300030959|Ga0102747_11289297All Organisms → cellular organisms → Eukaryota → Sar601Open in IMG/M
3300031062|Ga0073989_13580531All Organisms → cellular organisms → Eukaryota → Sar534Open in IMG/M
3300031556|Ga0308142_1021357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae941Open in IMG/M
3300031558|Ga0308147_1021022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae811Open in IMG/M
3300031597|Ga0302116_1198286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae597Open in IMG/M
3300031673|Ga0307377_10717756All Organisms → cellular organisms → Eukaryota → Sar701Open in IMG/M
3300031689|Ga0308017_1085195All Organisms → cellular organisms → Eukaryota → Sar652Open in IMG/M
3300031737|Ga0307387_10615670All Organisms → cellular organisms → Eukaryota → Sar679Open in IMG/M
3300032018|Ga0315272_10332916All Organisms → cellular organisms → Eukaryota → Sar741Open in IMG/M
3300032092|Ga0315905_11560753All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300032136|Ga0316201_11419473All Organisms → cellular organisms → Eukaryota → Sar576Open in IMG/M
3300032435|Ga0335398_10687038All Organisms → cellular organisms → Eukaryota → Sar664Open in IMG/M
3300032481|Ga0314668_10240335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae930Open in IMG/M
3300032517|Ga0314688_10768596All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300032518|Ga0314689_10573645All Organisms → cellular organisms → Eukaryota → Sar586Open in IMG/M
3300032518|Ga0314689_10736053All Organisms → cellular organisms → Eukaryota → Sar503Open in IMG/M
3300032713|Ga0314690_10653065All Organisms → cellular organisms → Eukaryota → Sar511Open in IMG/M
3300032714|Ga0314686_10409852All Organisms → cellular organisms → Eukaryota → Sar673Open in IMG/M
3300032744|Ga0314705_10343132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae802Open in IMG/M
3300032750|Ga0314708_10217712All Organisms → cellular organisms → Eukaryota → Sar931Open in IMG/M
3300032754|Ga0314692_10503377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae650Open in IMG/M
3300032755|Ga0314709_10613961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae657Open in IMG/M
3300033978|Ga0334977_0123776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1361Open in IMG/M
3300033980|Ga0334981_0272933All Organisms → cellular organisms → Eukaryota → Sar758Open in IMG/M
3300034008|Ga0334942_141496All Organisms → cellular organisms → Eukaryota → Sar568Open in IMG/M
3300034105|Ga0335035_0217500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1167Open in IMG/M
3300034107|Ga0335037_0112209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1483Open in IMG/M
3300034120|Ga0335056_0267301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae960Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine21.56%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.01%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.20%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.95%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water4.46%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.46%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.72%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.72%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.35%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water3.35%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica2.23%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.86%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.12%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment1.12%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.12%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral1.12%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.12%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.49%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.74%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.74%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.74%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.74%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.74%
EnviromentalEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental0.74%
Pond SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil0.74%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral0.74%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.74%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.74%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.37%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.37%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.37%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.37%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.37%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.37%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.37%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.37%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.37%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.37%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.37%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.37%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.37%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.37%
Microbial MatsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Microbial Mats0.37%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.37%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.37%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.37%
Bay WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water0.37%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000126Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5mEnvironmentalOpen in IMG/M
3300000385Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1EnvironmentalOpen in IMG/M
3300000418Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1EnvironmentalOpen in IMG/M
3300002154Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 MetagenomeEnvironmentalOpen in IMG/M
3300003292Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C27A4_80 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003554Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_04_M0_20 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003684Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004639Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI048_120m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004764Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005595Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47BEnvironmentalOpen in IMG/M
3300005596Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43BEnvironmentalOpen in IMG/M
3300006128Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07EnvironmentalOpen in IMG/M
3300006129Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006714Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 DCM_B metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007213Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 NT10 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007522Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007608Marine microbial communities from the Southern Atlantic ocean - KN S19 Surf_B metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300008013Coral microbial communities from Puerto Morelos, Mexico - Orbicella T R C metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008030Coral microbial communities from Puerto Morelos, Mexico - Siderastrea T C metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008673Planktonic microbial communities from coastal waters of California, USA - Canon-48EnvironmentalOpen in IMG/M
3300008689Planktonic microbial communities from coastal waters of California, USA - Canon-58EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008921Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NB1EnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008953Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009052Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02EnvironmentalOpen in IMG/M
3300009061Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_D2_MGEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009129Combined Assembly of Gp0139513, Gp0139514EnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009218Microbial communities of water from Amazon river, Brazil - RCM1EnvironmentalOpen in IMG/M
3300009225Microbial communities of water from Amazon river, Brazil - RCM4EnvironmentalOpen in IMG/M
3300009228Microbial communities of water from Amazon river, Brazil - RCM7EnvironmentalOpen in IMG/M
3300009247Microbial communities of water from Amazon river, Brazil - RCM14EnvironmentalOpen in IMG/M
3300009254Microbial communities of water from Amazon river, Brazil - RCM20EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009268Eukaryotic communities of water from the North Atlantic ocean - ACM43EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009272Eukaryotic communities of water from the North Atlantic ocean - ACM45EnvironmentalOpen in IMG/M
3300009333Microbial communities of water from the North Atlantic ocean - ACM52EnvironmentalOpen in IMG/M
3300009340Microbial communities of water from the North Atlantic ocean - ACM60EnvironmentalOpen in IMG/M
3300009344Microbial communities of water from the North Atlantic ocean - ACM58EnvironmentalOpen in IMG/M
3300009353Microbial communities of water from the North Atlantic ocean - ACM49EnvironmentalOpen in IMG/M
3300009370Combined Assembly of Gp0127930, Gp0127931EnvironmentalOpen in IMG/M
3300009385Microbial communities of water from Amazon river, Brazil - RCM5EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009516Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300009537Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2WEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009722Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_241_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009747Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_197_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009756Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_202_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009864Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, surface; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010007Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #4 sample T4Host-AssociatedOpen in IMG/M
3300010018Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #1 sample H1Host-AssociatedOpen in IMG/M
3300010031Coral microbial communities from La Bocana,Puerto Morelos, Mexico - Diploria C A metagenomeHost-AssociatedOpen in IMG/M
3300010129Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_237_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010135Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300012370Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012687Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES032 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012688Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES030 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012710Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012732Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012742Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES027 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012765Freshwater microbial communities from Lake Croche, Canada - C_131016_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012771Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012775Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012785Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES011 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012786Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES010 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013123 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016696Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES024 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017503Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in f/2 medium with seawater, no silicate, 15 C, 29.4 psu salinity and 472 ?mol photons light - Neoceratium fusus PA161109 (MMETSP1074)Host-AssociatedOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017989Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaGEnvironmentalOpen in IMG/M
3300017990Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaGEnvironmentalOpen in IMG/M
3300018065Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaGEnvironmentalOpen in IMG/M
3300018574Metatranscriptome of marine microbial communities from Baltic Sea - GS677_3p0_dTEnvironmentalOpen in IMG/M
3300018575Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782379-ERR1712162)EnvironmentalOpen in IMG/M
3300018592Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782094-ERR1712047)EnvironmentalOpen in IMG/M
3300018602Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782193-ERR1711945)EnvironmentalOpen in IMG/M
3300018610Metatranscriptome of marine microbial communities from Baltic Sea - LD35M_ls2EnvironmentalOpen in IMG/M
3300018637Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000837 (ERX1782121-ERR1712056)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018660Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000589 (ERX1782392-ERR1711993)EnvironmentalOpen in IMG/M
3300018662Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018667Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001334 (ERX1782401-ERR1711946)EnvironmentalOpen in IMG/M
3300018696Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000864 (ERX1782143-ERR1711870)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018824Metatranscriptome of marine microbial communities from Baltic Sea - GS850_ls4EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018834Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789722-ERR1719319)EnvironmentalOpen in IMG/M
3300018840Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000013 (ERX1782199-ERR1712136)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018853Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782437-ERR1712106)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018901Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782459-ERR1712126)EnvironmentalOpen in IMG/M
3300018912Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782195-ERR1712243)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018940Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105)EnvironmentalOpen in IMG/M
3300018945Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001608 (ERX1789687-ERR1719388)EnvironmentalOpen in IMG/M
3300018960Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789423-ERR1719357)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018983Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019075Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002400 (ERX1782374-ERR1711926)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019104Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782308-ERR1711955)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019824Microbial mat bacterial communities from Rhone River delta, Camargue, France - 3EnvironmentalOpen in IMG/M
3300020240Marine microbial communities from Tara Oceans - TARA_B000000477 (ERX556046-ERR598982)EnvironmentalOpen in IMG/M
3300020338Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX555920-ERR599099)EnvironmentalOpen in IMG/M
3300020392Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021296Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R881 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022375Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023230Saline water microbial communities from Ace Lake, Antarctica - #1692EnvironmentalOpen in IMG/M
3300024252 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_135_MGEnvironmentalOpen in IMG/M
3300024334Seawater microbial communities from Monterey Bay, California, United States - 89DEnvironmentalOpen in IMG/M
3300024534Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024851Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024863Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300026197Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026423Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026426Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 23R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026427Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 1R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026437Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 34R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027264APAL treatment metatranscriptome co-assemblyHost-AssociatedOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300028337Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 38R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300030924Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_V_5 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030959Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031556Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_538_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031558Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031597Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCMEnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031689Marine microbial communities from water near the shore, Antarctic Ocean - #280EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032435Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 (spades assembly)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300034008Biocrust microbial communities from Mojave Desert, California, United States - 38SMCEnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BS_KBB_SWE26_205mDRAFT_106096423300000126MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSGCEKEEIPK*
PR_CR_10_Liq_1_inCRDRAFT_102627933300000385EnviromentalMKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGIICKGVSNPQASNALSGCEKEENPK*
P_2C_Liq_1_UnCtyDRAFT_107258023300000418EnviromentalVKIEDNKIMNPAFLLGTDLNIAYWDRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
JGI24538J26636_1006243733300002154MarineMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGC
Ga0006242J48907_10235513300003292SeawaterLISPKKKRMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0006242J48907_10677723300003292SeawaterMKIEVNKIMKPAFLLGIAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDTPK*
Ga0008451J51688_10167123300003554SeawaterMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0005851_103588123300003684Freshwater And SedimentVRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEKEEIPK*
Ga0031658_106133113300003860Freshwater Lake SedimentMKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEI
Ga0066620_124096823300004639MarineMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQASIALSGCEKEEIP
Ga0007754_104100833300004764Freshwater LakeMRIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCE
Ga0007748_1009243823300004769Freshwater LakeKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQASNALSGCEKEENPK*
Ga0007748_1013987223300004769Freshwater LakeMNTEVNKTMNPAFLFGIDFNIEYWHRKYHSGTICKGVNDGEASNALSGCEKDITIK*
Ga0007761_1005496813300004792Freshwater LakeEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSECEKEQIPK*
Ga0007761_1012812713300004792Freshwater LakeMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQATKALSGCEREEIPK*
Ga0007756_1006138623300004795Freshwater LakeMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSECEKEQIPK*
Ga0007796_1016244233300004804FreshwaterMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0007854_1035990413300004806FreshwaterVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0049085_1005887213300005583Freshwater LenticMKIEVNNIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*V*RRYRERI
Ga0066833_1016699833300005595MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEE
Ga0066834_1021289723300005596MarineMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEK
Ga0007828_110591713300006128FreshwaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNAFTGCEKEEIPKCVP
Ga0007834_113595213300006129FreshwaterMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIP
Ga0075501_106959123300006355AqueousMISAKKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0075513_102767213300006379AqueousNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCENEEIPK*
Ga0075513_109014423300006379AqueousMKIEVNKTMNPAFLLGTAFKRAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0075494_100020533300006382AqueousKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCERA*
Ga0075488_109106413300006397AqueousMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREE
Ga0075506_110689713300006401AqueousGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0075514_122422413300006403AqueousAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0075471_1038901623300006641AqueousVPKEKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0079246_127095423300006714MarineMNPEFLLGTAFNIAYWHRKYHSGTICKGVTNPHTSNALSGCDKE*
Ga0075472_1050198723300006917AqueousMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0079255_125981713300007213MarineMKIEVNKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDTPK*
Ga0105053_1049455013300007522FreshwaterMVPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEENCK*
Ga0102818_109289213300007552EstuarineTSSIKIMNPAFLLGTAFNIAYWDRKYHSGTICKGVSNTQTSNALSGCEKEEIP*
Ga0102800_126781123300007608MarineMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0102825_105580333300007655EstuarineVKIEDNKIMNPAFLLGTAFNIAYWDRKYHSGTICKGVSNTQTSNALSGCEKEEIP*
Ga0105736_104712623300007861Estuary WaterMKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0105740_104975233300007955Estuary WaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNRQTSNALSGCEKEEI
Ga0099809_1003472113300008013CoralMRIEVKKIMNPDILLGTAFKIAYWHRKYHSGTICKGVSNGQASNALSECETEEIPK*
Ga0099821_100519413300008030CoralMKIEVNKIMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREEKPK*
Ga0103941_1073923300008673Coastal WaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0103948_1069923300008689Coastal WaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCESEEIPK*
Ga0103882_1002367523300008834Surface Ocean WaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVTNPHTSNALSGCDKE*
Ga0103882_1002969613300008834Surface Ocean WaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGCEREETPK*
Ga0103882_1004627913300008834Surface Ocean WaterMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREEIPK*
Ga0103882_1005653823300008834Surface Ocean WaterMNPAFLLGTAFNIAYWHKKYHSGTICKGVIKGQASNALSGCDKEETPK*
Ga0103882_1007114313300008834Surface Ocean WaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103486_101145523300008921Bay WaterMKTEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103733_106252013300008930Ice Edge, Mcmurdo Sound, AntarcticaNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0103734_105381123300008931Ice Edge, Mcmurdo Sound, AntarcticaMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103734_105732523300008931Ice Edge, Mcmurdo Sound, AntarcticaMRTEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNVQTSNALSGCEREETPK*
Ga0103737_101115523300008934Ice Edge, Mcmurdo Sound, AntarcticaMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNGQASNALSGCEKEEIPK*
Ga0103739_104584023300008936Ice Edge, Mcmurdo Sound, AntarcticaMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0104241_101049513300008953FreshwaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIMK*
Ga0103502_1018728123300008998MarineIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0103710_1008984123300009006Ocean WaterMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0103710_1012751413300009006Ocean WaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPKLD*
Ga0102811_116742433300009024EstuarineMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEFSCPR
Ga0102886_124456713300009052EstuarineHYYSWALTSSIKIMNPAFLLGTAFNIAYWDRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0102938_1051548723300009061Pond SoilMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGCEKEENPK*
Ga0114973_1034028713300009068Freshwater LakeVKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQASNALSGCEKEENPK*
Ga0114973_1049631613300009068Freshwater LakeMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTTKALSGCEK
Ga0102814_1044646623300009079EstuarineMKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCE
Ga0102812_1028455623300009086EstuarineMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEI
Ga0118728_111920833300009129MarineGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0114976_1034296333300009184Freshwater LakeVKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVNNPQASNALSGCEKEENPK*
Ga0103842_103631723300009216River WaterMRIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103848_102490123300009218River WaterMNTEVNKTMNPAFLLGTDFNIEYWHRKYHSGTICKGVNDGEASNALSGCEKDITIK*
Ga0103851_102531813300009225River WaterMNPAFLFGTAFNIAYWHRKYHSGTICKGVNNAQASNALSVCEREENPK*
Ga0103854_100338823300009228River WaterMNPAFLFGTAFNIAYWHRKYHSGTICKGVNNAQASNALSGCEREENPK*
Ga0103861_1001070723300009247River WaterMRIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0103861_1002270813300009247River WaterMNIEVNKIMNPAFLLGTDFNIEYWHRKYHSGTICKGVNDGEASNALSGCEKDITIK*
Ga0103867_101767323300009254River WaterMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGCEREQIPK*
Ga0103873_102611313300009265Surface Ocean WaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQSSKALSVCEKEEIPK*
Ga0103874_100532623300009268Surface Ocean WaterMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVRNAQGSKALSVCEREETPK*
Ga0103876_107699613300009269Surface Ocean WaterMKIEVSKIMKPAFLLGTAFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREVI
Ga0103877_101453123300009272Surface Ocean WaterMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQGSKALSVCEREETPK*
Ga0103833_100311723300009333River WaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEAYEKNLKEKEVKNRKD
Ga0103838_100504623300009340River WaterMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVTNPHTSNALSGCDKE*
Ga0103834_100657023300009344River WaterMKINIEVNNIMNPAFLLGTAFNIAYWHRKYHSGTICKGVTNPQTSNALSGCDKE*
Ga0103847_100033623300009353River WaterMRIEVNKAMNPAFLLGIAFKIAYWHRKYHSGTICKGVSNGQASNALSGCEREEIPK*
Ga0118716_111600613300009370MarineMNPAFLLGTAFNIAYWQRKYHSGTICKGVMNPHTSNALSGCDKE*
Ga0103852_100094043300009385River WaterMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103742_100559223300009402Ice Edge, Mcmurdo Sound, AntarcticaFNIAYWHRKYHSGTICKGVSNALTSKALSGCEREDTPK*
Ga0115008_1059304033300009436MarineVKIEVNKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0129359_101381413300009516Meromictic PondLGKAFNIAYWHRKYHSGTICKGVSKEQASNALSGCEREETPK*
Ga0114919_1028067713300009529Deep SubsurfaceMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQTSNALSGCEKEEIPK*
Ga0129283_1048128013300009537Beach Aquifer PorewaterNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSIALSECEKEQIPK*
Ga0115099_1081720623300009543MarineMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGCEREENPKCVCRKYR*
Ga0115006_1007590033300009544MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEMPK*
Ga0115006_1137633323300009544MarineLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0115006_1191801413300009544MarineKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEMPK
Ga0115013_1058642713300009550MarineMKIEVNKIMKPAFLLGIAFNIAYWHRKYHSGTICKGVSNPLTSKALSGCEREDIPK*
Ga0115101_123723623300009592MarineMNPEFLFGIAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREENPKCVCRKYK*
Ga0115101_125562823300009592MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAEASNALSGCEREE
Ga0115011_1096568023300009593MarineMKIEVNNIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSG
Ga0115100_1115132513300009608MarineEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0123378_11626423300009722MarineLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGWEREETPK*
Ga0123377_105843113300009735MarinePAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGWDKEEIPK*
Ga0123363_103626313300009747MarineKKKRVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVRNAQGSKALSVCEREETPK
Ga0123366_102984933300009756MarineMETEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCERQETPK*
Ga0115001_1064973213300009785MarineAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKASLRDWY*
Ga0132193_10486723300009864Meromictic PondMNPAFLLGRAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0133909_10003723300010007Host-AssociatedMKIEVNKIMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGCEKEEKPK*
Ga0133896_100000423300010018Host-AssociatedMNPEFLFGTAFNIAYWHRKYHSGTMCKGVSNPQASNALSGCEKEENPK*
Ga0126337_1055917213300010031CoralMNPAFLFGTAFNIAYWQRKYHSGTMCKGVSNPQASNALSGCEKEENPK*
Ga0123376_111388013300010129MarineKKRARIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVRNAQASNALSGCEREETPK*
Ga0123382_116533313300010135MarineNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQASNALSGCEKEEIPK*
Ga0118733_10786403713300010430Marine SedimentMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGCEKEENPKCICRRYR*
Ga0133913_1361186913300010885Freshwater LakeMNPSFLLGTAFKIAYWQRKYHSGTICKGVSNGQTSFALSGC
Ga0138316_1078610723300010981MarineMNPAFLFGTAFNIANWQRKYHSGTICKGVSNPQTSNALSGCEKEEI
Ga0123369_109504913300012370MarineEVNKIMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREEIPK*
Ga0138265_141332613300012408Polar MarineMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREENPK*
Ga0138264_172465813300012414Polar MarineMNIEVNNIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCESEETPK
Ga0138264_179656313300012414Polar MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCESEETPK
Ga0129325_114478123300012516AqueousMRIEVNKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGWEREETPK*
Ga0129349_123712613300012518AqueousLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK*
Ga0129352_1003431813300012528AqueousIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0157543_118651213300012687FreshwaterTAFNIAYWHRKYHSGTICKGVSNPQTSNAFTGCEKVMAEDC*
Ga0157541_114417413300012688FreshwaterVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNAFTGCEKVMAEDC*
Ga0157550_116669323300012710FreshwaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEI
Ga0157549_117520413300012732FreshwaterLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNAFTGCEKVMAEDC*
Ga0157539_16063113300012742FreshwaterFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNAFTGCEKVMAEDC*
Ga0138274_116797113300012765Freshwater LakeIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQATKALSGCEREEIPK*
Ga0138270_119240023300012771Freshwater LakeLGTAFNIAY*HRKYHSGTICKGVINGQASNALSGCDKVEIP*
Ga0138270_128783713300012771Freshwater LakeMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQATKALSGCEREEIPK*
Ga0138280_121997213300012775Freshwater LakeEVNKIMNPAFLLGIAFNIAY*HKKYHSGTICKGVSNPHTSNALSGCEKEEIPK*
Ga0157528_12343013300012785FreshwaterKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK*
Ga0157527_18048623300012786FreshwaterAFLFGTAFNIAYWHRKYHSGTICKGVNNPQASNALSGCEKEENETKVNQK*
Ga0163179_1206141713300012953SeawaterMKINIEVNNIMNPAFLLGTAFNIPYWHRKYHSGTICKGVINPLTSNALSGCDKL
Ga0129341_114774613300012966AqueousMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSG*
Ga0129341_130634713300012966AqueousMNPAFLLGTAFKIEYWHRKYHSGTICKGVSNPQSSKALSVCEKEEIPK*
(restricted) Ga0172368_1032816323300013123FreshwaterMKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
(restricted) Ga0172373_1063099023300013131FreshwaterMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKVEIPKL
Ga0170791_1596080113300013295FreshwaterMNIEVNKIMNPAFLLGTDFNIEYWHRKYHSGTICKGVNDGETSNALSGCEKDITIK*
Ga0180049_111759613300016696FreshwaterKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNAFTGCEKVMAEDC
Ga0186372_104950213300017503Host-AssociatedMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVRNPQSSKALSVCEKEEIPK
Ga0187220_113527123300017768SeawaterVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNRQTSNALSGCEKEEIPK
Ga0181580_1072840523300017956Salt MarshMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIP
Ga0180432_1121488823300017989Hypersaline Lake SedimentVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPKCEPETDS
Ga0180436_1157870413300017990Hypersaline Lake SedimentMNPAFLFGTAFNIAYXHKKYHSGTICKGVSNPHASNALSGCEKEENPKCIXRRYR
Ga0180430_1072938213300018065Hypersaline Lake SedimentIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQHTATANESLER
Ga0188842_100431813300018574Freshwater LakeMKKVKIEVNKTMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0193474_101245523300018575MarineMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREENPKCVCRKYR
Ga0193113_102535523300018592MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0193182_101647213300018602MarineMNPAFLLGTAFNIAYXHRKYHSGTICNGVSSEQASNALSGCEREEIPRCVC
Ga0188884_100573713300018610Freshwater LakeMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSDALSGCEKEEIPK
Ga0192914_101914323300018637MarineMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0193445_103083323300018648MarineMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREEKPKXIXRKYR
Ga0193067_105499713300018659MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGCDKEEIPK
Ga0193130_101540423300018660MarineMKIEVNKIMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREEKPK
Ga0192848_102703223300018662MarineMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEKEEKPKXIXRRYR
Ga0193159_105259823300018666MarineVRTEVNKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0193127_102417913300018667MarineMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREEAPKXVCRKYR
Ga0193110_102315213300018696MarineMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREENPKXTXRRYR
Ga0192887_103272113300018713MarineMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEMPK
Ga0193000_106409023300018745MarineMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAEASNALSGCEREET
Ga0192950_107092413300018791MarineLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEENKKENK
Ga0193183_106151523300018811MarineVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0188874_101552813300018824Freshwater LakeMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREENPKXVXRKYR
Ga0193048_106323713300018825MarineVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEMPK
Ga0192877_106095213300018834MarineVIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0193200_108714633300018840MarineLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGCEREEIPK
Ga0193312_100979023300018844MarineMNPVFLFGIAFNIVYXHKKYHSGTICKGVTNIQASNELSGCDNKHIP
Ga0193253_108974123300018846MarineVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0192958_110774113300018853MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEENKKENK
Ga0193553_112915723300018873MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCERGEIPK
Ga0193203_1007228323300018901MarineVNKIMNPAFLLGTAFNIAYWHKKYHSGTICKGVSNPQTSNALSGCEKEEI
Ga0193203_1022305813300018901MarineVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSGCEKEEMPK
Ga0193176_1011953323300018912MarineMNPAFLLGTAFNIAYWHKKYHSGTICKGVSNPQTSNALSGCEKEEI
Ga0193176_1023980013300018912MarineMKIEVKKIMNPEFLFEIPFKIPYWHRKYHSGTICKGVSNSQTSNALSGCEREEIKK
Ga0192955_1013842813300018930MarineMRTEVNKTMNPAFLLGTAFKRAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0192818_1019103913300018940MarineMNPAFLLGTAFNIAYWHKKYHSGTICKGVSNPQTSNALSGCDGFL
Ga0193287_111989713300018945MarineMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVTNPHTSNALSGCDKE
Ga0192930_1004167713300018960MarineMNPAFLLGTAFNIAYWHKKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0193531_1010565133300018961MarineMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQSSKALSVCEKEEIPK
Ga0193293_1002596833300018966MarineMRIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0193540_1021789313300018979MarineVIEVNKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0192961_1015789423300018980MarineMRIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEERIGDKPCVLS
Ga0193017_1026346413300018983MarineTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEKEEIPK
Ga0193554_1006162833300018986MarineMKIEVNKIMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREEKPKXIXRKYR
Ga0193275_1025413013300018988MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0193030_1013217023300018989MarineVNKIMNPAFLLGTAFNIAYWHRKYHSGIICKGVSNCQASNALSGCDKEETPK
Ga0193034_1020042623300019001MarineMNPAFLLGTAFKIAYWHRKYHSGTICKGVRNAQASNALSGCEREETPK
Ga0192982_1022684613300019021MarineMKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEKEETPK
Ga0192951_1014834423300019022MarineMKIEVNKIMNPAFLFGTAFNIANWQRKYHSGTICKGVSNAQASNALSGCEREE
Ga0193516_1013652713300019031MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNDQASNALSGCDKEETPK
Ga0192869_1029455923300019032MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVRNAQTSNALSGCEREETPK
Ga0193123_1030446113300019039MarineMNPDILLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGCE
Ga0193452_10742523300019075MarineMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREEIPKXVCRKYR
Ga0193045_106408913300019100MarineMKIEVNKIMNPAFLFGTAFNMANWQRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0193177_100664923300019104MarineINNKRIEVNKIMNPAFLLGTAFNIAYWHKKYHSGTICKGVSNAQTSNALSGCEKEEI
Ga0193144_101038923300019126MarineMRIEVNKIMNPAFLLGTAFNIAYXHRKYHSGTICKGVSNEQASNALSGCEREEIPRCVCK
Ga0193112_108358723300019136MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0197830_10616813300019824Microbial MatsMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGCEKEENPKCICRRYR
Ga0211494_107111013300020240MarineKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0211571_111598713300020338MarineMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKVEIPK
Ga0211666_1033586613300020392MarineFLISPKKKKVKIEVNKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0206687_175280313300021169SeawaterPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKQELHCK
Ga0210300_13315223300021296EstuarineVKIEDNKIMNPAFLLGTAFNIAYWDRKYHSGTICKGVSNTQASNALSGCEREEIP
Ga0210295_101704713300021323EstuarineFGTAFNIAYWHKKYHSGTICKGVNNAQASNALSGCEREENPK
Ga0063096_103784213300021925MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAEASNALSGCEREEMXKXVXRKYR
Ga0222714_1056050313300021961Estuarine WaterVKIEVNKIMVPAFLLGTAFNIEYWHRKYHSGTICKGVSNPQTSNALSGCEKEENCK
Ga0210313_103860323300022375EstuarineVRFLISPAKKRAKIEDNKIMNPAFLLGTAFNIAYWDRKYHSGTICKGVSNTQASNALSGCEKEEIP
Ga0222709_103566423300023230Saline WaterVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEE
(restricted) Ga0233435_102330013300024252SeawaterMNLISPKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPLTSNALSGCEKEEIPK
Ga0228671_116149313300024334SeawaterKKKVKIEVNNIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0256357_103580123300024534FreshwaterMRIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNAQACNALSGCEREETPK
Ga0255293_110020313300024851FreshwaterIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSG
Ga0255246_114360513300024863FreshwaterMVPAFLLGTAFNIEYWHRKYHSGTICKGVSNAQASNALSGCEREENCKXVXRKYRERTIMRA
Ga0209634_130860813300025138MarinePNKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIP
Ga0209925_120102813300026197Pond SoilMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGCEKEENPK
Ga0247557_104585023300026403SeawaterAFNIAYWHRKYHSGTICKGVSNAQASNALSGCESEEIPK
Ga0247580_108365523300026423SeawaterPNKYKRRIDVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIP
Ga0247570_108009613300026426SeawaterVKIEVNKTMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGCESEEIPK
Ga0247556_104790313300026427SeawaterEVNKIMNPAFLLGIAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0247577_109021013300026437SeawaterPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCESEEIPK
Ga0247592_110601723300026500SeawaterLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0247590_117860123300026513SeawaterAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0208921_104152513300027188EstuarineMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0255580_110677113300027264CoralNRMKIEVNKIMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGCEKEEKPK
Ga0255580_111423413300027264CoralNRMKIEVNKIMNPAFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEKEEKPK
Ga0209815_124494813300027714MarineIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
(restricted) Ga0247836_123712623300027728FreshwaterMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQASNALSGCEK
Ga0209190_115111023300027736Freshwater LakeMNPAFLLGIAFNIAYXHKKYHSGTICKGVSNPHTSNALSGCEKEE
Ga0209972_1021425813300027793Freshwater LakeMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSECEKEKKNKKFVGVYIS
Ga0209302_1023177833300027810MarineEFLFGTAFNIAYWQRKYHSGTICKGVSNPHASNALSGCEKEENPKCICRRYR
Ga0209092_1060315213300027833MarineVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVRNPQSSKALSVCEKEEIPK
Ga0209712_1076344313300027849MarineMKIEVNNIMNPAFLLGTAFNIAYXHRKYHSGTICKGVTNPQTSNALSGCEKEEIPKXVXRRYR
(restricted) Ga0233415_1050112513300027861SeawaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSGCEKEEIPK
Ga0209713_1001760213300027883MarineMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEM
Ga0209777_1057488813300027896Freshwater Lake SedimentKVKIEVNKIMNPAFLLGKAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0247582_103688723300028109SeawaterLLGTAFKIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0247582_110720013300028109SeawaterMKTEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCERQETPK
Ga0228642_110667313300028131SeawaterVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKQKCRVHNLI
Ga0247579_102590023300028337SeawaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVTNPHTSNALSGCDKE
Ga0304731_1128826023300028575MarineVKIEVNKIMNPAFLFGTAFNIANWQRKYHSGTICKGVSNPQTSNALSGCEKEEI
Ga0265309_1071753213300028599SedimentMNPAFLFGTAFNIAYXHKKYHSGTICKGVPNPQASNALSGCDKEEIPKXVXRKYSLVS
Ga0138348_157086923300030924MarineGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREETPK
Ga0102747_1128929723300030959SoilVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK
Ga0073989_1358053113300031062MarineAFLLGTAFNIAYWHRKYHSGTICKGVRNPQTSNALSGCEKEEIPK
Ga0308142_102135713300031556MarineMRTEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNVQTSNALSGCEREETQKLV
Ga0308147_102102213300031558MarineHKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVTNPHTSNALSGCDKE
Ga0302116_119828613300031597MarineSPKKKRVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0307377_1071775613300031673SoilLLGTAFNIAYWHRKYHSGTICKGVSNPQASNALSGCEKEEIPK
Ga0308017_108519513300031689MarineMMNPVFLLGTAFNIAYXHKKYHSGTICKGVNNQQTSNALSGCKKE
Ga0307387_1061567023300031737MarineMKIEVNNIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPETSNALSG
Ga0315272_1033291613300032018SedimentMKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0315905_1156075323300032092FreshwaterMVPAFLLGTAFNIEYWHRKYHSGTICKGVSNPQTSNALSGCEKEENCKXV
Ga0316201_1141947323300032136Worm BurrowKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0335398_1068703823300032435FreshwaterMVPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEENCKXV
Ga0314668_1024033523300032481SeawaterMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREEIPKXVCRKYR
Ga0314688_1076859613300032517SeawaterEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQGSKALSVCEREETPK
Ga0314689_1057364513300032518SeawaterVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASKALSGCEREETPK
Ga0314689_1073605313300032518SeawaterMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQSSKALSVCEKEEIPKXVXRRYRQR
Ga0314690_1065306513300032713SeawaterRFLISPKKMKVKIEVNKIMNPAFLLGTAFMIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0314686_1040985213300032714SeawaterMRAKIEVNKTMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAEASNALSGCEREET
Ga0314705_1034313213300032744SeawaterVKIEVNKIMNPAFLLGTAFKIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEMPK
Ga0314708_1021771213300032750SeawaterMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQSSKALSVCEKEEIPK
Ga0314692_1050337733300032754SeawaterMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNAHASNALSGCEREEIPK
Ga0314709_1061396113300032755SeawaterFLLGTAFNIAYWHRKYHSGTICKGVSNAEASNALSGCEREET
Ga0334977_0123776_1_1923300033978FreshwaterENAKKKKVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSGCEKEEIPK
Ga0334981_0272933_502_6723300033980FreshwaterMKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSKALSECEKEQIPK
Ga0334942_141496_56_2533300034008BiocrustVPDGYIGREKFVEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPK
Ga0335035_0217500_1_1443300034105FreshwaterMKIEVNKIMNPAFLFGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSG
Ga0335037_0112209_788_9853300034107FreshwaterMKMEVNKIMNPEFLLGTAFNIAYWHRKYHSGTICKGVNNVETSDALSGCENIKIKKLFWNKIILI
Ga0335056_0267301_212_3883300034120FreshwaterVKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNPQTSNALSGCEKEEIPKLV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.