Sample 3300019824

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300019824

3300019824: Microbial mat bacterial communities from Rhone River delta, Camargue, France - 3

Overview

Basic Information
IMG/M Taxon OID	3300019824 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0129318 \| Gp0220894 \| Ga0197830
Sample Name	Microbial mat bacterial communities from Rhone River delta, Camargue, France - 3
Sequencing Status	Permanent Draft
Sequencing Center	University of Barcelona
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	27317365
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Mat Bacterial Communities From Rhone River Delta, Camargue, France
Type	Environmental
Taxonomy	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Microbial Mats → Microbial Mat Bacterial Communities From Rhone River Delta, Camargue, France

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater river biome → delta → microbial mat material
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	Rhone delta, Camargue, France, EU
Coordinates	Lat. (^o)	43.6	Long. (^o)	4.6	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013645	Metagenome / Metatranscriptome	269	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0197830_106168	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	523	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0197830_106168	Ga0197830_1061681	F013645	MNPEFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGCEKEENPKCICRRYR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.