NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002039

3300002039: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B3



Overview

Basic Information
IMG/M Taxon OID3300002039 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0103015 | Gp0060411 | Ga0016929
Sample NameDelisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B3
Sequencing StatusPermanent Draft
Sequencing Center
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size1010422860
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDelisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease
TypeHost-Associated
TaxonomyHost-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationLong Bay, Sydney, Australia
CoordinatesLat. (o)-33.57Long. (o)151.15Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002549Metagenome / Metatranscriptome549Y
F009809Metagenome / Metatranscriptome312Y
F078742Metagenome / Metatranscriptome116Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
LBB32012_10033882Not Available1630Open in IMG/M
LBB32012_10037381All Organisms → cellular organisms → Eukaryota1526Open in IMG/M
LBB32012_10074122All Organisms → cellular organisms → Eukaryota990Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
LBB32012_10033882LBB32012_100338823F002549MSKLLKILGVGATPLIDKAVEVADKFIDTPEEKKAFIKEAYEQEVQDRKEARELGKNKSTPDVLTYITLVIACGLGVAIFTDIINWSTLTEVQKGLITTFSGFFLRTLGDVYGYWFGSSMGSEGKTHDLTKLM
LBB32012_10037381LBB32012_100373814F078742VEQLSVGTGSDLIDYGRLEVKEDGSWDVLASSSLAEEGVEGIVSSSDGLIRWHLTVWLDTVLKAEQFPTGVTNLNTSLSDMD*
LBB32012_10074122LBB32012_100741221F009809LGEEDFRDAKSIIELLKENLTLWKEEEEGGQGDDA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.