


| Basic Information | |
|---|---|
| Family ID | F001756 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 641 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| Number of Associated Samples | 408 |
| Number of Associated Scaffolds | 641 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.14 % |
| % of genes near scaffold ends (potentially truncated) | 79.88 % |
| % of genes from short scaffolds (< 2000 bps) | 95.63 % |
| Associated GOLD sequencing projects | 371 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.034 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (25.741 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.735 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.924 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 641 Family Scaffolds |
|---|---|---|
| PF03446 | NAD_binding_2 | 46.02 |
| PF14833 | NAD_binding_11 | 35.10 |
| PF12766 | Pyridox_oxase_2 | 5.62 |
| PF07690 | MFS_1 | 2.65 |
| PF00132 | Hexapep | 1.56 |
| PF00578 | AhpC-TSA | 0.62 |
| PF01192 | RNA_pol_Rpb6 | 0.47 |
| PF01593 | Amino_oxidase | 0.16 |
| PF01925 | TauE | 0.16 |
| PF03328 | HpcH_HpaI | 0.16 |
| PF00484 | Pro_CA | 0.16 |
| PF00534 | Glycos_transf_1 | 0.16 |
| PF13378 | MR_MLE_C | 0.16 |
| PF13439 | Glyco_transf_4 | 0.16 |
| PF02515 | CoA_transf_3 | 0.16 |
| PF01243 | Putative_PNPOx | 0.16 |
| COG ID | Name | Functional Category | % Frequency in 641 Family Scaffolds |
|---|---|---|---|
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.47 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.16 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.16 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.16 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.16 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.16 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.16 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.03 % |
| Unclassified | root | N/A | 41.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559017|JCVI_READ_729586 | Not Available | 933 | Open in IMG/M |
| 2222084003|2222363549 | Not Available | 572 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10185968 | Not Available | 588 | Open in IMG/M |
| 3300000142|LPaug09P16500mDRAFT_c1018765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1185 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1021872 | Not Available | 510 | Open in IMG/M |
| 3300000181|LPjun08P4500mDRAFT_c1015116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1156 | Open in IMG/M |
| 3300000181|LPjun08P4500mDRAFT_c1017066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1066 | Open in IMG/M |
| 3300000247|LPaug09P26500mDRAFT_1015643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1149 | Open in IMG/M |
| 3300000259|LP_J_08_P26_500DRAFT_1015365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1152 | Open in IMG/M |
| 3300000260|LP_A_09_P20_500DRAFT_1025986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 807 | Open in IMG/M |
| 3300001346|JGI20151J14362_10115632 | Not Available | 880 | Open in IMG/M |
| 3300001346|JGI20151J14362_10161543 | Not Available | 656 | Open in IMG/M |
| 3300001349|JGI20160J14292_10119146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 891 | Open in IMG/M |
| 3300001349|JGI20160J14292_10180547 | Not Available | 629 | Open in IMG/M |
| 3300001349|JGI20160J14292_10198662 | Not Available | 583 | Open in IMG/M |
| 3300001354|JGI20155J14468_10134168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 813 | Open in IMG/M |
| 3300001676|TuiMalila_1019714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1667 | Open in IMG/M |
| 3300001944|GOS2251_1004658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1994 | Open in IMG/M |
| 3300001944|GOS2251_1035235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1800 | Open in IMG/M |
| 3300001945|GOS2241_1025985 | Not Available | 763 | Open in IMG/M |
| 3300001946|GOS2244_1053954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1818 | Open in IMG/M |
| 3300001947|GOS2218_1021885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1490 | Open in IMG/M |
| 3300001953|GOS2231_1030127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1601 | Open in IMG/M |
| 3300001954|GOS2235_1051448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1645 | Open in IMG/M |
| 3300001955|GOS2237_1000097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1796 | Open in IMG/M |
| 3300001959|GOS2247_1027286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1287 | Open in IMG/M |
| 3300001960|GOS2230_1000581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1635 | Open in IMG/M |
| 3300001960|GOS2230_1022994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1743 | Open in IMG/M |
| 3300001960|GOS2230_1046211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
| 3300001960|GOS2230_1057199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1832 | Open in IMG/M |
| 3300001962|GOS2239_1020930 | Not Available | 1852 | Open in IMG/M |
| 3300001964|GOS2234_1060257 | Not Available | 1708 | Open in IMG/M |
| 3300001965|GOS2243_1010222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1541 | Open in IMG/M |
| 3300001965|GOS2243_1015857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 968 | Open in IMG/M |
| 3300001965|GOS2243_1081170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1691 | Open in IMG/M |
| 3300001966|GOS2245_1010226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1653 | Open in IMG/M |
| 3300001966|GOS2245_1069477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1103 | Open in IMG/M |
| 3300001966|GOS2245_1090552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1085 | Open in IMG/M |
| 3300001966|GOS2245_1105573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1817 | Open in IMG/M |
| 3300001966|GOS2245_1107370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1337 | Open in IMG/M |
| 3300001966|GOS2245_1127191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1237 | Open in IMG/M |
| 3300001969|GOS2233_1059242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1760 | Open in IMG/M |
| 3300001969|GOS2233_1060610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1718 | Open in IMG/M |
| 3300001969|GOS2233_1113157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1485 | Open in IMG/M |
| 3300001972|GOS2216_10004265 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300001972|GOS2216_10036990 | Not Available | 1819 | Open in IMG/M |
| 3300001974|GOS2246_10021491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2734 | Open in IMG/M |
| 3300001974|GOS2246_10133381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1814 | Open in IMG/M |
| 3300001974|GOS2246_10184625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 977 | Open in IMG/M |
| 3300002033|GOS24894_10015089 | Not Available | 1590 | Open in IMG/M |
| 3300002033|GOS24894_10026957 | Not Available | 1886 | Open in IMG/M |
| 3300002033|GOS24894_10128741 | Not Available | 1707 | Open in IMG/M |
| 3300002033|GOS24894_10176802 | Not Available | 1886 | Open in IMG/M |
| 3300002033|GOS24894_10273273 | Not Available | 1410 | Open in IMG/M |
| 3300002033|GOS24894_10333696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1335 | Open in IMG/M |
| 3300002033|GOS24894_10500376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1654 | Open in IMG/M |
| 3300002040|GOScombined01_100120529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1592 | Open in IMG/M |
| 3300002040|GOScombined01_100171353 | Not Available | 926 | Open in IMG/M |
| 3300002040|GOScombined01_100304341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1566 | Open in IMG/M |
| 3300002040|GOScombined01_100367580 | Not Available | 780 | Open in IMG/M |
| 3300002040|GOScombined01_100725989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 600 | Open in IMG/M |
| 3300002040|GOScombined01_100887421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1704 | Open in IMG/M |
| 3300002040|GOScombined01_101562037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1804 | Open in IMG/M |
| 3300002040|GOScombined01_101806637 | Not Available | 903 | Open in IMG/M |
| 3300002040|GOScombined01_102507731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 914 | Open in IMG/M |
| 3300002040|GOScombined01_102592222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1707 | Open in IMG/M |
| 3300002040|GOScombined01_104937788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 787 | Open in IMG/M |
| 3300002040|GOScombined01_105195854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 940 | Open in IMG/M |
| 3300002040|GOScombined01_106175215 | Not Available | 809 | Open in IMG/M |
| 3300002040|GOScombined01_107007050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1262 | Open in IMG/M |
| 3300002186|JGI24539J26755_10228127 | Not Available | 537 | Open in IMG/M |
| 3300002242|KVWGV2_10234693 | Not Available | 722 | Open in IMG/M |
| 3300002955|JGI26062J44793_1012622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1020 | Open in IMG/M |
| 3300002965|JGI26063J44948_1027179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1228 | Open in IMG/M |
| 3300003474|NAP4_1024383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1123 | Open in IMG/M |
| 3300003474|NAP4_1043258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 876 | Open in IMG/M |
| 3300003476|NAP2_1140669 | Not Available | 542 | Open in IMG/M |
| 3300003477|nap3_10057006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 889 | Open in IMG/M |
| 3300003500|JGI26242J51144_1052664 | Not Available | 673 | Open in IMG/M |
| 3300003584|JGI26254J51713_1095035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 505 | Open in IMG/M |
| 3300003645|NAP1_1029012 | Not Available | 697 | Open in IMG/M |
| 3300004276|Ga0066610_10293323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 514 | Open in IMG/M |
| 3300004276|Ga0066610_10298891 | Not Available | 509 | Open in IMG/M |
| 3300004277|Ga0066611_10189121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 706 | Open in IMG/M |
| 3300005074|Ga0070431_1285560 | Not Available | 501 | Open in IMG/M |
| 3300005097|Ga0072505_1397651 | Not Available | 813 | Open in IMG/M |
| 3300005239|Ga0073579_1012934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1009 | Open in IMG/M |
| 3300005239|Ga0073579_1449083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 941 | Open in IMG/M |
| 3300005398|Ga0066858_10005424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3998 | Open in IMG/M |
| 3300005398|Ga0066858_10106829 | Not Available | 816 | Open in IMG/M |
| 3300005399|Ga0066860_10181621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 720 | Open in IMG/M |
| 3300005400|Ga0066867_10011065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3884 | Open in IMG/M |
| 3300005402|Ga0066855_10197555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 652 | Open in IMG/M |
| 3300005408|Ga0066848_10099985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 789 | Open in IMG/M |
| 3300005408|Ga0066848_10226127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 500 | Open in IMG/M |
| 3300005422|Ga0066829_10032379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1646 | Open in IMG/M |
| 3300005422|Ga0066829_10033510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1617 | Open in IMG/M |
| 3300005424|Ga0066826_10240864 | Not Available | 616 | Open in IMG/M |
| 3300005426|Ga0066847_10006508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3900 | Open in IMG/M |
| 3300005514|Ga0066866_10025111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2334 | Open in IMG/M |
| 3300005514|Ga0066866_10060198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1426 | Open in IMG/M |
| 3300005514|Ga0066866_10134236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 891 | Open in IMG/M |
| 3300005514|Ga0066866_10233195 | Not Available | 639 | Open in IMG/M |
| 3300005521|Ga0066862_10107603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 951 | Open in IMG/M |
| 3300005521|Ga0066862_10195873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 669 | Open in IMG/M |
| 3300005522|Ga0066861_10049256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1499 | Open in IMG/M |
| 3300005522|Ga0066861_10184700 | Not Available | 716 | Open in IMG/M |
| 3300005522|Ga0066861_10202355 | Not Available | 680 | Open in IMG/M |
| 3300005523|Ga0066865_10332511 | Not Available | 575 | Open in IMG/M |
| 3300005592|Ga0066838_10064070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1043 | Open in IMG/M |
| 3300005592|Ga0066838_10204955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 551 | Open in IMG/M |
| 3300005604|Ga0066852_10177291 | Not Available | 738 | Open in IMG/M |
| 3300005605|Ga0066850_10154940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 843 | Open in IMG/M |
| 3300005606|Ga0066835_10096829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 939 | Open in IMG/M |
| 3300005606|Ga0066835_10135635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 807 | Open in IMG/M |
| 3300005838|Ga0008649_10042992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2039 | Open in IMG/M |
| 3300005931|Ga0075119_1071122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 811 | Open in IMG/M |
| 3300005934|Ga0066377_10234046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 567 | Open in IMG/M |
| 3300005934|Ga0066377_10286027 | Not Available | 511 | Open in IMG/M |
| 3300005946|Ga0066378_10086621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 972 | Open in IMG/M |
| 3300005946|Ga0066378_10095108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 926 | Open in IMG/M |
| 3300005946|Ga0066378_10120979 | Not Available | 815 | Open in IMG/M |
| 3300005960|Ga0066364_10270646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 594 | Open in IMG/M |
| 3300005960|Ga0066364_10323195 | Not Available | 542 | Open in IMG/M |
| 3300005960|Ga0066364_10325376 | Not Available | 540 | Open in IMG/M |
| 3300005971|Ga0066370_10017504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2022 | Open in IMG/M |
| 3300005971|Ga0066370_10137831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 831 | Open in IMG/M |
| 3300005971|Ga0066370_10241191 | Not Available | 638 | Open in IMG/M |
| 3300005971|Ga0066370_10255080 | Not Available | 621 | Open in IMG/M |
| 3300005971|Ga0066370_10272893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 601 | Open in IMG/M |
| 3300005971|Ga0066370_10293605 | Not Available | 580 | Open in IMG/M |
| 3300005971|Ga0066370_10349787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 532 | Open in IMG/M |
| 3300006019|Ga0066375_10128754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 802 | Open in IMG/M |
| 3300006024|Ga0066371_10286140 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006025|Ga0075474_10230391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 561 | Open in IMG/M |
| 3300006026|Ga0075478_10082442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1034 | Open in IMG/M |
| 3300006027|Ga0075462_10177812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 645 | Open in IMG/M |
| 3300006166|Ga0066836_10451417 | Not Available | 776 | Open in IMG/M |
| 3300006166|Ga0066836_10510295 | Not Available | 727 | Open in IMG/M |
| 3300006166|Ga0066836_10532873 | Not Available | 711 | Open in IMG/M |
| 3300006166|Ga0066836_10749372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 591 | Open in IMG/M |
| 3300006191|Ga0075447_10144307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 802 | Open in IMG/M |
| 3300006193|Ga0075445_10301824 | Not Available | 541 | Open in IMG/M |
| 3300006308|Ga0068470_1131980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 964 | Open in IMG/M |
| 3300006308|Ga0068470_1557642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 684 | Open in IMG/M |
| 3300006310|Ga0068471_1356095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1150 | Open in IMG/M |
| 3300006315|Ga0068487_1317346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 964 | Open in IMG/M |
| 3300006329|Ga0068486_1047900 | Not Available | 709 | Open in IMG/M |
| 3300006329|Ga0068486_1085134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1213 | Open in IMG/M |
| 3300006329|Ga0068486_1288380 | Not Available | 588 | Open in IMG/M |
| 3300006334|Ga0099675_1468087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1533 | Open in IMG/M |
| 3300006334|Ga0099675_1573123 | Not Available | 562 | Open in IMG/M |
| 3300006334|Ga0099675_1631735 | Not Available | 808 | Open in IMG/M |
| 3300006337|Ga0068495_1287937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2743 | Open in IMG/M |
| 3300006337|Ga0068495_1515332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300006337|Ga0068495_1583217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1293 | Open in IMG/M |
| 3300006341|Ga0068493_10622857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300006345|Ga0099693_1546451 | Not Available | 571 | Open in IMG/M |
| 3300006350|Ga0099954_1044483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 734 | Open in IMG/M |
| 3300006402|Ga0075511_1208821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 858 | Open in IMG/M |
| 3300006412|Ga0099955_1191410 | Not Available | 512 | Open in IMG/M |
| 3300006412|Ga0099955_1249838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300006413|Ga0099963_1237203 | Not Available | 511 | Open in IMG/M |
| 3300006425|Ga0075486_1048838 | Not Available | 740 | Open in IMG/M |
| 3300006478|Ga0100224_1185115 | Not Available | 643 | Open in IMG/M |
| 3300006480|Ga0100226_1123155 | Not Available | 610 | Open in IMG/M |
| 3300006480|Ga0100226_1458741 | Not Available | 637 | Open in IMG/M |
| 3300006480|Ga0100226_1614819 | Not Available | 579 | Open in IMG/M |
| 3300006481|Ga0100229_1503968 | Not Available | 585 | Open in IMG/M |
| 3300006565|Ga0100228_1393726 | Not Available | 700 | Open in IMG/M |
| 3300006843|Ga0068496_141671 | Not Available | 857 | Open in IMG/M |
| 3300007041|Ga0101669_106928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1034 | Open in IMG/M |
| 3300007041|Ga0101669_107357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1009 | Open in IMG/M |
| 3300007074|Ga0075110_1109572 | Not Available | 570 | Open in IMG/M |
| 3300007114|Ga0101668_1140984 | Not Available | 515 | Open in IMG/M |
| 3300007116|Ga0101667_1049356 | Not Available | 753 | Open in IMG/M |
| 3300007144|Ga0101670_1028966 | Not Available | 887 | Open in IMG/M |
| 3300007152|Ga0101672_1082846 | Not Available | 549 | Open in IMG/M |
| 3300007283|Ga0066366_10125637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1008 | Open in IMG/M |
| 3300007331|Ga0079271_1331712 | Not Available | 569 | Open in IMG/M |
| 3300007332|Ga0079256_1012230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1158 | Open in IMG/M |
| 3300007337|Ga0079244_1337922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1182 | Open in IMG/M |
| 3300007338|Ga0079242_1346436 | Not Available | 858 | Open in IMG/M |
| 3300007338|Ga0079242_1380029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 834 | Open in IMG/M |
| 3300007340|Ga0079241_1296590 | Not Available | 738 | Open in IMG/M |
| 3300007554|Ga0102820_1119210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 635 | Open in IMG/M |
| 3300007557|Ga0102821_1073780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 875 | Open in IMG/M |
| 3300007622|Ga0102863_1193870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 597 | Open in IMG/M |
| 3300007623|Ga0102948_1042886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1459 | Open in IMG/M |
| 3300007634|Ga0102901_1060293 | Not Available | 1095 | Open in IMG/M |
| 3300007644|Ga0102902_1216908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 563 | Open in IMG/M |
| 3300007681|Ga0102824_1039899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1245 | Open in IMG/M |
| 3300007692|Ga0102823_1172388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 576 | Open in IMG/M |
| 3300007772|Ga0105672_1086271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300007954|Ga0105739_1126474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 597 | Open in IMG/M |
| 3300007956|Ga0105741_1101406 | Not Available | 703 | Open in IMG/M |
| 3300007957|Ga0105742_1065653 | Not Available | 534 | Open in IMG/M |
| 3300008097|Ga0111541_10108649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1126 | Open in IMG/M |
| 3300008097|Ga0111541_10117617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1083 | Open in IMG/M |
| 3300008097|Ga0111541_10146621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 973 | Open in IMG/M |
| 3300008624|Ga0115652_1087395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1018 | Open in IMG/M |
| 3300008735|Ga0115657_1173997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1173 | Open in IMG/M |
| 3300008954|Ga0115650_1223267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1125 | Open in IMG/M |
| 3300009001|Ga0102963_1440020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 511 | Open in IMG/M |
| 3300009027|Ga0102957_1041286 | Not Available | 1581 | Open in IMG/M |
| 3300009056|Ga0102860_1261981 | Not Available | 502 | Open in IMG/M |
| 3300009071|Ga0115566_10027981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4035 | Open in IMG/M |
| 3300009071|Ga0115566_10500672 | Not Available | 689 | Open in IMG/M |
| 3300009071|Ga0115566_10622451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 603 | Open in IMG/M |
| 3300009077|Ga0115552_1316465 | Not Available | 622 | Open in IMG/M |
| 3300009079|Ga0102814_10617289 | Not Available | 594 | Open in IMG/M |
| 3300009086|Ga0102812_10757970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 537 | Open in IMG/M |
| 3300009109|Ga0117922_1020014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4569 | Open in IMG/M |
| 3300009109|Ga0117922_1153921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1062 | Open in IMG/M |
| 3300009130|Ga0118729_1034262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3129 | Open in IMG/M |
| 3300009141|Ga0102884_1192548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 520 | Open in IMG/M |
| 3300009172|Ga0114995_10647788 | Not Available | 577 | Open in IMG/M |
| 3300009172|Ga0114995_10793981 | Not Available | 518 | Open in IMG/M |
| 3300009173|Ga0114996_11231862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 523 | Open in IMG/M |
| 3300009375|Ga0118721_1126751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1036 | Open in IMG/M |
| 3300009376|Ga0118722_1055780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3063 | Open in IMG/M |
| 3300009376|Ga0118722_1336758 | Not Available | 803 | Open in IMG/M |
| 3300009420|Ga0114994_10471956 | Not Available | 828 | Open in IMG/M |
| 3300009420|Ga0114994_10574646 | Not Available | 740 | Open in IMG/M |
| 3300009420|Ga0114994_10602821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 720 | Open in IMG/M |
| 3300009420|Ga0114994_10662219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 682 | Open in IMG/M |
| 3300009420|Ga0114994_11033220 | Not Available | 531 | Open in IMG/M |
| 3300009422|Ga0114998_10477706 | Not Available | 584 | Open in IMG/M |
| 3300009425|Ga0114997_10132962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1486 | Open in IMG/M |
| 3300009425|Ga0114997_10151225 | Not Available | 1372 | Open in IMG/M |
| 3300009425|Ga0114997_10309468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 872 | Open in IMG/M |
| 3300009425|Ga0114997_10482880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 662 | Open in IMG/M |
| 3300009425|Ga0114997_10615594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 571 | Open in IMG/M |
| 3300009426|Ga0115547_1155734 | Not Available | 730 | Open in IMG/M |
| 3300009432|Ga0115005_10900488 | Not Available | 714 | Open in IMG/M |
| 3300009437|Ga0115556_1142440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 888 | Open in IMG/M |
| 3300009437|Ga0115556_1155754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 841 | Open in IMG/M |
| 3300009447|Ga0115560_1338560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 571 | Open in IMG/M |
| 3300009472|Ga0115554_1217060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 772 | Open in IMG/M |
| 3300009472|Ga0115554_1229228 | Not Available | 747 | Open in IMG/M |
| 3300009481|Ga0114932_10066046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2290 | Open in IMG/M |
| 3300009481|Ga0114932_10178945 | Not Available | 1295 | Open in IMG/M |
| 3300009481|Ga0114932_10299274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 964 | Open in IMG/M |
| 3300009495|Ga0115571_1286019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 657 | Open in IMG/M |
| 3300009497|Ga0115569_10468591 | Not Available | 536 | Open in IMG/M |
| 3300009497|Ga0115569_10521145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 500 | Open in IMG/M |
| 3300009498|Ga0115568_10331782 | Not Available | 668 | Open in IMG/M |
| 3300009508|Ga0115567_10378142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 875 | Open in IMG/M |
| 3300009508|Ga0115567_10551608 | Not Available | 698 | Open in IMG/M |
| 3300009512|Ga0115003_10537586 | Not Available | 683 | Open in IMG/M |
| 3300009544|Ga0115006_11202567 | Not Available | 678 | Open in IMG/M |
| 3300009593|Ga0115011_10159338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1643 | Open in IMG/M |
| 3300009593|Ga0115011_10626645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 870 | Open in IMG/M |
| 3300009593|Ga0115011_10661919 | Not Available | 849 | Open in IMG/M |
| 3300009593|Ga0115011_11208827 | Not Available | 652 | Open in IMG/M |
| 3300009703|Ga0114933_10299290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1067 | Open in IMG/M |
| 3300009703|Ga0114933_10322015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1023 | Open in IMG/M |
| 3300009703|Ga0114933_10361430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 955 | Open in IMG/M |
| 3300009703|Ga0114933_10811331 | Not Available | 596 | Open in IMG/M |
| 3300009703|Ga0114933_10923927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 554 | Open in IMG/M |
| 3300009703|Ga0114933_10957959 | Not Available | 542 | Open in IMG/M |
| 3300009703|Ga0114933_11019579 | Not Available | 523 | Open in IMG/M |
| 3300009705|Ga0115000_10316851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1006 | Open in IMG/M |
| 3300009705|Ga0115000_10346043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 954 | Open in IMG/M |
| 3300009785|Ga0115001_10110638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1798 | Open in IMG/M |
| 3300009785|Ga0115001_10664453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 633 | Open in IMG/M |
| 3300009785|Ga0115001_10997838 | Not Available | 501 | Open in IMG/M |
| 3300009786|Ga0114999_10947545 | Not Available | 626 | Open in IMG/M |
| 3300009790|Ga0115012_10806878 | Not Available | 761 | Open in IMG/M |
| 3300009790|Ga0115012_11377164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 601 | Open in IMG/M |
| 3300009790|Ga0115012_11535181 | Not Available | 574 | Open in IMG/M |
| 3300010297|Ga0129345_1170806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 779 | Open in IMG/M |
| 3300010299|Ga0129342_1141939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 880 | Open in IMG/M |
| 3300010299|Ga0129342_1274386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 583 | Open in IMG/M |
| 3300010883|Ga0133547_10701725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2004 | Open in IMG/M |
| 3300010883|Ga0133547_10796217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1857 | Open in IMG/M |
| 3300010883|Ga0133547_10818535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1826 | Open in IMG/M |
| 3300010883|Ga0133547_11393223 | Not Available | 1324 | Open in IMG/M |
| 3300011013|Ga0114934_10262443 | Not Available | 785 | Open in IMG/M |
| 3300011312|Ga0138349_1111733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 579 | Open in IMG/M |
| 3300011330|Ga0138383_1219644 | Not Available | 500 | Open in IMG/M |
| 3300011331|Ga0138384_1070048 | Not Available | 769 | Open in IMG/M |
| 3300012520|Ga0129344_1065995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 587 | Open in IMG/M |
| 3300012919|Ga0160422_10021075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3782 | Open in IMG/M |
| 3300012919|Ga0160422_10385405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 871 | Open in IMG/M |
| 3300012919|Ga0160422_10505815 | Not Available | 760 | Open in IMG/M |
| 3300012928|Ga0163110_10271007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1231 | Open in IMG/M |
| 3300012928|Ga0163110_10391849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1039 | Open in IMG/M |
| 3300012928|Ga0163110_10422543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1003 | Open in IMG/M |
| 3300012928|Ga0163110_11023099 | Not Available | 659 | Open in IMG/M |
| 3300012928|Ga0163110_11132348 | Not Available | 627 | Open in IMG/M |
| 3300012928|Ga0163110_11580167 | Not Available | 533 | Open in IMG/M |
| 3300012928|Ga0163110_11776541 | Not Available | 503 | Open in IMG/M |
| 3300012936|Ga0163109_10791663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 693 | Open in IMG/M |
| 3300012936|Ga0163109_10871512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 658 | Open in IMG/M |
| 3300012950|Ga0163108_10626129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 695 | Open in IMG/M |
| 3300012950|Ga0163108_11116461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 508 | Open in IMG/M |
| 3300012952|Ga0163180_11270157 | Not Available | 604 | Open in IMG/M |
| 3300012952|Ga0163180_11329503 | Not Available | 593 | Open in IMG/M |
| 3300012953|Ga0163179_10173567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1630 | Open in IMG/M |
| 3300012953|Ga0163179_10721263 | Not Available | 848 | Open in IMG/M |
| 3300012953|Ga0163179_11526632 | Not Available | 602 | Open in IMG/M |
| 3300012953|Ga0163179_11829370 | Not Available | 555 | Open in IMG/M |
| 3300012954|Ga0163111_10120619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 2180 | Open in IMG/M |
| 3300012954|Ga0163111_12595664 | Not Available | 517 | Open in IMG/M |
| 3300012963|Ga0129340_1010466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1133 | Open in IMG/M |
| 3300012963|Ga0129340_1205544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 812 | Open in IMG/M |
| 3300012967|Ga0129343_1031583 | Not Available | 508 | Open in IMG/M |
| 3300012969|Ga0129332_1160244 | Not Available | 682 | Open in IMG/M |
| 3300013010|Ga0129327_10614693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 601 | Open in IMG/M |
| 3300013188|Ga0116834_1053224 | Not Available | 765 | Open in IMG/M |
| 3300013188|Ga0116834_1073264 | Not Available | 678 | Open in IMG/M |
| 3300013253|Ga0116813_1057283 | Not Available | 664 | Open in IMG/M |
| 3300014973|Ga0134293_1012664 | Not Available | 1189 | Open in IMG/M |
| 3300016729|Ga0182056_1086083 | Not Available | 677 | Open in IMG/M |
| 3300016733|Ga0182042_1354431 | Not Available | 718 | Open in IMG/M |
| 3300016735|Ga0182074_1038067 | Not Available | 568 | Open in IMG/M |
| 3300016758|Ga0182070_1301787 | Not Available | 508 | Open in IMG/M |
| 3300016771|Ga0182082_1517813 | Not Available | 519 | Open in IMG/M |
| 3300016781|Ga0182063_1188156 | Not Available | 560 | Open in IMG/M |
| 3300016781|Ga0182063_1602648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1331 | Open in IMG/M |
| 3300016791|Ga0182095_1566767 | Not Available | 509 | Open in IMG/M |
| 3300017697|Ga0180120_10340812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 594 | Open in IMG/M |
| 3300017714|Ga0181412_1125228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 590 | Open in IMG/M |
| 3300017730|Ga0181417_1067487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 869 | Open in IMG/M |
| 3300017730|Ga0181417_1080535 | Not Available | 789 | Open in IMG/M |
| 3300017731|Ga0181416_1067513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 845 | Open in IMG/M |
| 3300017734|Ga0187222_1110667 | Not Available | 619 | Open in IMG/M |
| 3300017734|Ga0187222_1120275 | Not Available | 589 | Open in IMG/M |
| 3300017745|Ga0181427_1096198 | Not Available | 724 | Open in IMG/M |
| 3300017752|Ga0181400_1161909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 631 | Open in IMG/M |
| 3300017752|Ga0181400_1215294 | Not Available | 526 | Open in IMG/M |
| 3300017755|Ga0181411_1167727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 627 | Open in IMG/M |
| 3300017756|Ga0181382_1070194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 980 | Open in IMG/M |
| 3300017765|Ga0181413_1072755 | Not Available | 1054 | Open in IMG/M |
| 3300017767|Ga0181406_1159085 | Not Available | 676 | Open in IMG/M |
| 3300017771|Ga0181425_1144218 | Not Available | 756 | Open in IMG/M |
| 3300017773|Ga0181386_1186663 | Not Available | 626 | Open in IMG/M |
| 3300017776|Ga0181394_1070129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1152 | Open in IMG/M |
| 3300017776|Ga0181394_1191750 | Not Available | 625 | Open in IMG/M |
| 3300017781|Ga0181423_1079369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1296 | Open in IMG/M |
| 3300017782|Ga0181380_1290975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 536 | Open in IMG/M |
| 3300017786|Ga0181424_10092359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 1307 | Open in IMG/M |
| 3300017786|Ga0181424_10144902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1019 | Open in IMG/M |
| 3300017786|Ga0181424_10446130 | Not Available | 522 | Open in IMG/M |
| 3300017818|Ga0181565_10457290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 834 | Open in IMG/M |
| 3300017949|Ga0181584_10586575 | Not Available | 676 | Open in IMG/M |
| 3300017949|Ga0181584_10591579 | Not Available | 673 | Open in IMG/M |
| 3300017950|Ga0181607_10160693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1355 | Open in IMG/M |
| 3300017950|Ga0181607_10585384 | Not Available | 588 | Open in IMG/M |
| 3300017962|Ga0181581_10602136 | Not Available | 669 | Open in IMG/M |
| 3300017969|Ga0181585_10203186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1419 | Open in IMG/M |
| 3300017985|Ga0181576_10384446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 878 | Open in IMG/M |
| 3300018036|Ga0181600_10374907 | Not Available | 696 | Open in IMG/M |
| 3300018036|Ga0181600_10393615 | Not Available | 674 | Open in IMG/M |
| 3300018049|Ga0181572_10646305 | Not Available | 640 | Open in IMG/M |
| 3300018415|Ga0181559_10590781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 599 | Open in IMG/M |
| 3300018416|Ga0181553_10432426 | Not Available | 711 | Open in IMG/M |
| 3300018418|Ga0181567_10968480 | Not Available | 532 | Open in IMG/M |
| 3300018420|Ga0181563_10468592 | Not Available | 711 | Open in IMG/M |
| 3300018424|Ga0181591_11197944 | Not Available | 506 | Open in IMG/M |
| 3300018426|Ga0181566_10275690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1222 | Open in IMG/M |
| 3300019009|Ga0192880_10090961 | Not Available | 778 | Open in IMG/M |
| 3300019025|Ga0193545_10127971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 541 | Open in IMG/M |
| 3300019047|Ga0193549_10050602 | Not Available | 541 | Open in IMG/M |
| 3300019261|Ga0182097_1506737 | Not Available | 848 | Open in IMG/M |
| 3300019276|Ga0182067_1519516 | Not Available | 549 | Open in IMG/M |
| 3300019283|Ga0182058_1198665 | Not Available | 728 | Open in IMG/M |
| 3300019459|Ga0181562_10267846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 862 | Open in IMG/M |
| 3300019765|Ga0194024_1025035 | Not Available | 1285 | Open in IMG/M |
| 3300020051|Ga0181555_1097245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1311 | Open in IMG/M |
| 3300020053|Ga0181595_10174171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 967 | Open in IMG/M |
| 3300020194|Ga0181597_10253277 | Not Available | 815 | Open in IMG/M |
| 3300020194|Ga0181597_10460080 | Not Available | 519 | Open in IMG/M |
| 3300020207|Ga0181570_10048556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2527 | Open in IMG/M |
| 3300020207|Ga0181570_10274509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 856 | Open in IMG/M |
| 3300020237|Ga0211478_100728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1817 | Open in IMG/M |
| 3300020237|Ga0211478_102231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 849 | Open in IMG/M |
| 3300020266|Ga0211519_1034335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1067 | Open in IMG/M |
| 3300020272|Ga0211566_1054074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 872 | Open in IMG/M |
| 3300020280|Ga0211591_1035347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1071 | Open in IMG/M |
| 3300020280|Ga0211591_1058798 | Not Available | 810 | Open in IMG/M |
| 3300020281|Ga0211483_10079636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1076 | Open in IMG/M |
| 3300020281|Ga0211483_10090166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1009 | Open in IMG/M |
| 3300020296|Ga0211474_1056713 | Not Available | 597 | Open in IMG/M |
| 3300020312|Ga0211542_1041217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 876 | Open in IMG/M |
| 3300020313|Ga0211485_1022392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1180 | Open in IMG/M |
| 3300020328|Ga0211567_1040771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1036 | Open in IMG/M |
| 3300020330|Ga0211572_1105525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 647 | Open in IMG/M |
| 3300020332|Ga0211502_1113024 | Not Available | 507 | Open in IMG/M |
| 3300020334|Ga0211593_1017299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1564 | Open in IMG/M |
| 3300020359|Ga0211610_1114103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 633 | Open in IMG/M |
| 3300020361|Ga0211531_1148633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 621 | Open in IMG/M |
| 3300020370|Ga0211672_10209529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 602 | Open in IMG/M |
| 3300020370|Ga0211672_10228726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 575 | Open in IMG/M |
| 3300020370|Ga0211672_10288319 | Not Available | 507 | Open in IMG/M |
| 3300020374|Ga0211477_10244334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 617 | Open in IMG/M |
| 3300020375|Ga0211656_10096982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 919 | Open in IMG/M |
| 3300020376|Ga0211682_10294822 | Not Available | 611 | Open in IMG/M |
| 3300020382|Ga0211686_10356980 | Not Available | 595 | Open in IMG/M |
| 3300020382|Ga0211686_10450903 | Not Available | 515 | Open in IMG/M |
| 3300020383|Ga0211646_10305871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 562 | Open in IMG/M |
| 3300020384|Ga0211596_10128495 | Not Available | 784 | Open in IMG/M |
| 3300020391|Ga0211675_10103822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1300 | Open in IMG/M |
| 3300020391|Ga0211675_10247761 | Not Available | 765 | Open in IMG/M |
| 3300020391|Ga0211675_10448433 | Not Available | 526 | Open in IMG/M |
| 3300020395|Ga0211705_10309139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 586 | Open in IMG/M |
| 3300020395|Ga0211705_10313894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 581 | Open in IMG/M |
| 3300020396|Ga0211687_10065060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1600 | Open in IMG/M |
| 3300020397|Ga0211583_10197131 | Not Available | 735 | Open in IMG/M |
| 3300020400|Ga0211636_10279872 | Not Available | 638 | Open in IMG/M |
| 3300020402|Ga0211499_10218249 | Not Available | 678 | Open in IMG/M |
| 3300020409|Ga0211472_10075931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1316 | Open in IMG/M |
| 3300020411|Ga0211587_10235925 | Not Available | 759 | Open in IMG/M |
| 3300020413|Ga0211516_10175862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 991 | Open in IMG/M |
| 3300020413|Ga0211516_10454275 | Not Available | 564 | Open in IMG/M |
| 3300020415|Ga0211553_10319567 | Not Available | 628 | Open in IMG/M |
| 3300020416|Ga0211644_10202643 | Not Available | 814 | Open in IMG/M |
| 3300020416|Ga0211644_10259613 | Not Available | 714 | Open in IMG/M |
| 3300020417|Ga0211528_10278502 | Not Available | 629 | Open in IMG/M |
| 3300020418|Ga0211557_10104387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1398 | Open in IMG/M |
| 3300020418|Ga0211557_10169290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1036 | Open in IMG/M |
| 3300020418|Ga0211557_10171321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1028 | Open in IMG/M |
| 3300020419|Ga0211512_10092485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1420 | Open in IMG/M |
| 3300020419|Ga0211512_10372970 | Not Available | 644 | Open in IMG/M |
| 3300020421|Ga0211653_10241216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 789 | Open in IMG/M |
| 3300020424|Ga0211620_10226443 | Not Available | 800 | Open in IMG/M |
| 3300020426|Ga0211536_10165541 | Not Available | 861 | Open in IMG/M |
| 3300020428|Ga0211521_10268188 | Not Available | 764 | Open in IMG/M |
| 3300020429|Ga0211581_10173158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 874 | Open in IMG/M |
| 3300020430|Ga0211622_10182153 | Not Available | 903 | Open in IMG/M |
| 3300020430|Ga0211622_10299339 | Not Available | 689 | Open in IMG/M |
| 3300020432|Ga0211556_10150502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1082 | Open in IMG/M |
| 3300020432|Ga0211556_10200664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 915 | Open in IMG/M |
| 3300020433|Ga0211565_10073008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1468 | Open in IMG/M |
| 3300020436|Ga0211708_10127357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1006 | Open in IMG/M |
| 3300020437|Ga0211539_10397300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 575 | Open in IMG/M |
| 3300020439|Ga0211558_10256551 | Not Available | 825 | Open in IMG/M |
| 3300020440|Ga0211518_10375287 | Not Available | 660 | Open in IMG/M |
| 3300020442|Ga0211559_10357998 | Not Available | 676 | Open in IMG/M |
| 3300020445|Ga0211564_10259978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 857 | Open in IMG/M |
| 3300020445|Ga0211564_10607685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 531 | Open in IMG/M |
| 3300020446|Ga0211574_10155069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1000 | Open in IMG/M |
| 3300020446|Ga0211574_10290444 | Not Available | 707 | Open in IMG/M |
| 3300020448|Ga0211638_10383295 | Not Available | 658 | Open in IMG/M |
| 3300020448|Ga0211638_10606059 | Not Available | 515 | Open in IMG/M |
| 3300020449|Ga0211642_10035677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2211 | Open in IMG/M |
| 3300020449|Ga0211642_10112318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1179 | Open in IMG/M |
| 3300020449|Ga0211642_10169937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 942 | Open in IMG/M |
| 3300020449|Ga0211642_10184921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 899 | Open in IMG/M |
| 3300020450|Ga0211641_10439478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 627 | Open in IMG/M |
| 3300020451|Ga0211473_10349520 | Not Available | 758 | Open in IMG/M |
| 3300020453|Ga0211550_10235639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 858 | Open in IMG/M |
| 3300020454|Ga0211548_10095230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1420 | Open in IMG/M |
| 3300020454|Ga0211548_10471957 | Not Available | 615 | Open in IMG/M |
| 3300020455|Ga0211664_10119602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1234 | Open in IMG/M |
| 3300020455|Ga0211664_10445630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 595 | Open in IMG/M |
| 3300020456|Ga0211551_10165800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1047 | Open in IMG/M |
| 3300020456|Ga0211551_10502901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 578 | Open in IMG/M |
| 3300020458|Ga0211697_10148065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 972 | Open in IMG/M |
| 3300020459|Ga0211514_10308750 | Not Available | 778 | Open in IMG/M |
| 3300020459|Ga0211514_10425662 | Not Available | 653 | Open in IMG/M |
| 3300020460|Ga0211486_10193226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 891 | Open in IMG/M |
| 3300020461|Ga0211535_10312744 | Not Available | 704 | Open in IMG/M |
| 3300020461|Ga0211535_10351579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 665 | Open in IMG/M |
| 3300020461|Ga0211535_10474425 | Not Available | 572 | Open in IMG/M |
| 3300020463|Ga0211676_10219346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1136 | Open in IMG/M |
| 3300020463|Ga0211676_10614338 | Not Available | 555 | Open in IMG/M |
| 3300020464|Ga0211694_10413709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 580 | Open in IMG/M |
| 3300020465|Ga0211640_10057283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2284 | Open in IMG/M |
| 3300020465|Ga0211640_10175808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1214 | Open in IMG/M |
| 3300020465|Ga0211640_10215291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
| 3300020465|Ga0211640_10528637 | Not Available | 641 | Open in IMG/M |
| 3300020465|Ga0211640_10603513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 592 | Open in IMG/M |
| 3300020466|Ga0211714_10278670 | Not Available | 800 | Open in IMG/M |
| 3300020467|Ga0211713_10680054 | Not Available | 500 | Open in IMG/M |
| 3300020468|Ga0211475_10064482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1958 | Open in IMG/M |
| 3300020468|Ga0211475_10407658 | Not Available | 658 | Open in IMG/M |
| 3300020469|Ga0211577_10253173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1134 | Open in IMG/M |
| 3300020469|Ga0211577_10691701 | Not Available | 599 | Open in IMG/M |
| 3300020471|Ga0211614_10131405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1071 | Open in IMG/M |
| 3300020471|Ga0211614_10195343 | Not Available | 876 | Open in IMG/M |
| 3300020472|Ga0211579_10751633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 541 | Open in IMG/M |
| 3300020473|Ga0211625_10270378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 880 | Open in IMG/M |
| 3300020473|Ga0211625_10419005 | Not Available | 670 | Open in IMG/M |
| 3300020474|Ga0211547_10619625 | Not Available | 535 | Open in IMG/M |
| 3300020475|Ga0211541_10045494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2207 | Open in IMG/M |
| 3300020477|Ga0211585_10122072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1745 | Open in IMG/M |
| 3300020477|Ga0211585_10356149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 861 | Open in IMG/M |
| 3300020477|Ga0211585_10378577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 826 | Open in IMG/M |
| 3300020478|Ga0211503_10564236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 596 | Open in IMG/M |
| 3300021169|Ga0206687_1150537 | Not Available | 731 | Open in IMG/M |
| 3300021347|Ga0213862_10227684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 657 | Open in IMG/M |
| 3300021368|Ga0213860_10402226 | Not Available | 592 | Open in IMG/M |
| 3300021375|Ga0213869_10203354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 891 | Open in IMG/M |
| 3300021375|Ga0213869_10204419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 888 | Open in IMG/M |
| 3300021375|Ga0213869_10255574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 764 | Open in IMG/M |
| 3300021375|Ga0213869_10418849 | Not Available | 544 | Open in IMG/M |
| 3300021957|Ga0222717_10672277 | Not Available | 533 | Open in IMG/M |
| 3300022074|Ga0224906_1064212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1144 | Open in IMG/M |
| 3300022074|Ga0224906_1098479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 867 | Open in IMG/M |
| 3300022225|Ga0187833_10606261 | Not Available | 543 | Open in IMG/M |
| 3300022843|Ga0222631_1026592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 825 | Open in IMG/M |
| 3300022853|Ga0222652_1028241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 898 | Open in IMG/M |
| 3300022909|Ga0255755_1289941 | Not Available | 575 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10280292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 653 | Open in IMG/M |
| 3300022925|Ga0255773_10348624 | Not Available | 582 | Open in IMG/M |
| 3300022928|Ga0255758_10232146 | Not Available | 832 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10399843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 539 | Open in IMG/M |
| 3300022939|Ga0255754_10416499 | Not Available | 597 | Open in IMG/M |
| 3300023105|Ga0255782_10235430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 888 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10447810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 552 | Open in IMG/M |
| 3300023116|Ga0255751_10382588 | Not Available | 702 | Open in IMG/M |
| 3300023172|Ga0255766_10273149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 876 | Open in IMG/M |
| 3300023245|Ga0222655_1020520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1182 | Open in IMG/M |
| 3300023699|Ga0228695_1023776 | Not Available | 861 | Open in IMG/M |
| 3300024301|Ga0233451_10384225 | Not Available | 511 | Open in IMG/M |
| (restricted) 3300024339|Ga0233445_1061517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1330 | Open in IMG/M |
| 3300025265|Ga0208467_1042202 | Not Available | 724 | Open in IMG/M |
| 3300025643|Ga0209151_1124963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 671 | Open in IMG/M |
| 3300025653|Ga0208428_1059120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1146 | Open in IMG/M |
| 3300025665|Ga0209360_1120067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 754 | Open in IMG/M |
| 3300025680|Ga0209306_1195017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 555 | Open in IMG/M |
| 3300025685|Ga0209095_1052480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1457 | Open in IMG/M |
| 3300025685|Ga0209095_1163226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 640 | Open in IMG/M |
| 3300025690|Ga0209505_1097956 | Not Available | 842 | Open in IMG/M |
| 3300025694|Ga0209406_1151954 | Not Available | 732 | Open in IMG/M |
| 3300025700|Ga0209661_1125029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 773 | Open in IMG/M |
| 3300025860|Ga0209119_1314836 | Not Available | 549 | Open in IMG/M |
| 3300025870|Ga0209666_1358892 | Not Available | 555 | Open in IMG/M |
| 3300025886|Ga0209632_10241667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 929 | Open in IMG/M |
| 3300025890|Ga0209631_10082122 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
| 3300025890|Ga0209631_10402759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 633 | Open in IMG/M |
| 3300025892|Ga0209630_10161031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1129 | Open in IMG/M |
| 3300025892|Ga0209630_10303451 | Not Available | 725 | Open in IMG/M |
| 3300025892|Ga0209630_10329794 | Not Available | 683 | Open in IMG/M |
| 3300025894|Ga0209335_10301612 | Not Available | 681 | Open in IMG/M |
| 3300025897|Ga0209425_10172981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1180 | Open in IMG/M |
| 3300026076|Ga0208261_1077740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 885 | Open in IMG/M |
| 3300026076|Ga0208261_1100286 | Not Available | 755 | Open in IMG/M |
| 3300026077|Ga0208749_1075421 | Not Available | 706 | Open in IMG/M |
| 3300026077|Ga0208749_1096594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 615 | Open in IMG/M |
| 3300026083|Ga0208878_1058504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 984 | Open in IMG/M |
| 3300026083|Ga0208878_1097298 | Not Available | 729 | Open in IMG/M |
| 3300026130|Ga0209961_1036443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1015 | Open in IMG/M |
| 3300026183|Ga0209932_1065758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 847 | Open in IMG/M |
| 3300026183|Ga0209932_1088045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 699 | Open in IMG/M |
| 3300026192|Ga0207986_1026981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1522 | Open in IMG/M |
| 3300026199|Ga0208638_1024704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2035 | Open in IMG/M |
| 3300026204|Ga0208521_1009057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3566 | Open in IMG/M |
| 3300026206|Ga0207988_1006771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3872 | Open in IMG/M |
| 3300026257|Ga0208407_1122979 | Not Available | 805 | Open in IMG/M |
| 3300026258|Ga0208130_1088625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 882 | Open in IMG/M |
| 3300026260|Ga0208408_1010900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3840 | Open in IMG/M |
| 3300026263|Ga0207992_1076420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 913 | Open in IMG/M |
| 3300026270|Ga0207993_1088425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 845 | Open in IMG/M |
| 3300026270|Ga0207993_1157944 | Not Available | 589 | Open in IMG/M |
| 3300026279|Ga0208411_1041676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1506 | Open in IMG/M |
| 3300026279|Ga0208411_1191562 | Not Available | 516 | Open in IMG/M |
| 3300026292|Ga0208277_1190582 | Not Available | 659 | Open in IMG/M |
| 3300026292|Ga0208277_1259848 | Not Available | 520 | Open in IMG/M |
| 3300026321|Ga0208764_10053225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2154 | Open in IMG/M |
| 3300026321|Ga0208764_10148119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1187 | Open in IMG/M |
| 3300026321|Ga0208764_10166568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1106 | Open in IMG/M |
| 3300026321|Ga0208764_10542816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 527 | Open in IMG/M |
| 3300026447|Ga0247607_1032471 | Not Available | 896 | Open in IMG/M |
| 3300027198|Ga0208163_1044936 | Not Available | 720 | Open in IMG/M |
| 3300027234|Ga0208170_1079829 | Not Available | 605 | Open in IMG/M |
| 3300027255|Ga0208681_1080410 | Not Available | 556 | Open in IMG/M |
| 3300027582|Ga0208971_1048244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1175 | Open in IMG/M |
| 3300027687|Ga0209710_1265128 | Not Available | 548 | Open in IMG/M |
| 3300027687|Ga0209710_1286548 | Not Available | 516 | Open in IMG/M |
| 3300027702|Ga0209036_1031534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1797 | Open in IMG/M |
| 3300027702|Ga0209036_1177618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 608 | Open in IMG/M |
| 3300027751|Ga0208304_10166152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 807 | Open in IMG/M |
| 3300027755|Ga0209034_10268528 | Not Available | 511 | Open in IMG/M |
| 3300027774|Ga0209433_10264751 | Not Available | 645 | Open in IMG/M |
| 3300027779|Ga0209709_10025310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3785 | Open in IMG/M |
| 3300027779|Ga0209709_10063085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2078 | Open in IMG/M |
| 3300027779|Ga0209709_10255156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 775 | Open in IMG/M |
| 3300027791|Ga0209830_10072377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1765 | Open in IMG/M |
| 3300027801|Ga0209091_10441707 | Not Available | 579 | Open in IMG/M |
| 3300027801|Ga0209091_10506970 | Not Available | 522 | Open in IMG/M |
| 3300027813|Ga0209090_10202068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1024 | Open in IMG/M |
| 3300027813|Ga0209090_10244377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 909 | Open in IMG/M |
| 3300027813|Ga0209090_10320273 | Not Available | 764 | Open in IMG/M |
| 3300027827|Ga0209035_10647216 | Not Available | 501 | Open in IMG/M |
| 3300027830|Ga0209359_10032067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1937 | Open in IMG/M |
| 3300027830|Ga0209359_10223248 | Not Available | 849 | Open in IMG/M |
| 3300027830|Ga0209359_10478383 | Not Available | 575 | Open in IMG/M |
| 3300027830|Ga0209359_10483271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 572 | Open in IMG/M |
| 3300027847|Ga0209402_10630853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 601 | Open in IMG/M |
| 3300027906|Ga0209404_10367778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 931 | Open in IMG/M |
| 3300028132|Ga0228649_1043116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS39 | 1225 | Open in IMG/M |
| 3300028136|Ga0228608_1071473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 990 | Open in IMG/M |
| 3300028194|Ga0257106_1249680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 594 | Open in IMG/M |
| 3300028196|Ga0257114_1168545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 830 | Open in IMG/M |
| 3300028196|Ga0257114_1216118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 699 | Open in IMG/M |
| 3300028196|Ga0257114_1323141 | Not Available | 526 | Open in IMG/M |
| 3300028279|Ga0228613_1088535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 728 | Open in IMG/M |
| 3300028287|Ga0257126_1114785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 943 | Open in IMG/M |
| 3300028489|Ga0257112_10312691 | Not Available | 525 | Open in IMG/M |
| 3300028535|Ga0257111_1096876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 933 | Open in IMG/M |
| 3300031143|Ga0308025_1203559 | Not Available | 675 | Open in IMG/M |
| 3300031143|Ga0308025_1280881 | Not Available | 543 | Open in IMG/M |
| 3300031510|Ga0308010_1138904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 915 | Open in IMG/M |
| 3300031519|Ga0307488_10715720 | Not Available | 564 | Open in IMG/M |
| 3300031598|Ga0308019_10325699 | Not Available | 566 | Open in IMG/M |
| 3300031630|Ga0308004_10030590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2351 | Open in IMG/M |
| 3300031644|Ga0308001_10331482 | Not Available | 564 | Open in IMG/M |
| 3300031659|Ga0307986_10380375 | Not Available | 569 | Open in IMG/M |
| 3300031695|Ga0308016_10367532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 515 | Open in IMG/M |
| 3300031721|Ga0308013_10175244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 802 | Open in IMG/M |
| 3300031721|Ga0308013_10182972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 780 | Open in IMG/M |
| 3300031757|Ga0315328_10408448 | Not Available | 788 | Open in IMG/M |
| 3300031775|Ga0315326_10932328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 533 | Open in IMG/M |
| 3300031785|Ga0310343_10095212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1901 | Open in IMG/M |
| 3300031785|Ga0310343_10326464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1093 | Open in IMG/M |
| 3300031785|Ga0310343_10782537 | Not Available | 716 | Open in IMG/M |
| 3300031785|Ga0310343_11236695 | Not Available | 564 | Open in IMG/M |
| 3300031851|Ga0315320_10997175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 506 | Open in IMG/M |
| 3300031886|Ga0315318_10498507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 694 | Open in IMG/M |
| 3300032006|Ga0310344_11129016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 653 | Open in IMG/M |
| 3300032006|Ga0310344_11233013 | Not Available | 619 | Open in IMG/M |
| 3300032011|Ga0315316_10444277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1089 | Open in IMG/M |
| 3300032011|Ga0315316_10649301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 879 | Open in IMG/M |
| 3300032011|Ga0315316_10858568 | Not Available | 746 | Open in IMG/M |
| 3300032011|Ga0315316_10920621 | Not Available | 715 | Open in IMG/M |
| 3300032011|Ga0315316_11421413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 548 | Open in IMG/M |
| 3300032032|Ga0315327_10181466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1318 | Open in IMG/M |
| 3300032032|Ga0315327_10380623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 883 | Open in IMG/M |
| 3300032047|Ga0315330_10474772 | Not Available | 759 | Open in IMG/M |
| 3300032073|Ga0315315_10222001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1763 | Open in IMG/M |
| 3300032073|Ga0315315_10304779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1484 | Open in IMG/M |
| 3300032073|Ga0315315_10896954 | Not Available | 801 | Open in IMG/M |
| 3300032073|Ga0315315_11009977 | Not Available | 746 | Open in IMG/M |
| 3300032073|Ga0315315_11479931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 589 | Open in IMG/M |
| 3300032088|Ga0315321_10730292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 571 | Open in IMG/M |
| 3300032820|Ga0310342_101197867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 898 | Open in IMG/M |
| 3300032820|Ga0310342_102094975 | Not Available | 677 | Open in IMG/M |
| 3300032820|Ga0310342_102827132 | Not Available | 579 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.74% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 19.66% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.71% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.08% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.74% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.28% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.12% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.81% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.34% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.34% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.03% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.72% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.72% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.72% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.72% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.56% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.56% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.40% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.09% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.62% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.62% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.62% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.47% |
| Volcanic Co2 Seep | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep | 0.47% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.47% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.31% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.31% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.31% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.31% |
| Marine Benthic Sponge Stylissa Massa Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated | 0.31% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.16% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.16% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine | 0.16% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.16% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.16% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.16% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.16% |
| Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 0.16% |
| Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 0.16% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.16% |
| Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 0.16% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.78% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.78% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559017 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573) | Environmental | Open in IMG/M |
| 2222084003 | Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Ctl_5_microcosm | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000142 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m | Environmental | Open in IMG/M |
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300000181 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 500m | Environmental | Open in IMG/M |
| 3300000247 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P26 500m | Environmental | Open in IMG/M |
| 3300000259 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_J_08_P26_500 | Environmental | Open in IMG/M |
| 3300000260 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P20_500 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001676 | Black smokers hydrothermal plume microbial communities from Tui Malila, Lau Basin, Pacific Ocean | Environmental | Open in IMG/M |
| 3300001944 | Marine microbial communities from Cabo Marshall, Isabella Island, Equador - GS036 | Environmental | Open in IMG/M |
| 3300001945 | Marine microbial communities from Galapagos, Equador - GS026 | Environmental | Open in IMG/M |
| 3300001946 | Marine microbial communities from North James Bay, Santigo Island, Equador | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300001953 | Marine microbial communities from Key West, Florida, USA - GS015 | Environmental | Open in IMG/M |
| 3300001954 | Marine microbial communities from Colon, Panama - GS019 | Environmental | Open in IMG/M |
| 3300001955 | Marine microbial communities from Gulf of Panama, Panama - GS021 | Environmental | Open in IMG/M |
| 3300001959 | Mangrove swamp microbial communities from Isabella Island, Equador - GS032 | Environmental | Open in IMG/M |
| 3300001960 | Marine microbial communities from South of Charleston, South Carolina, USA - GS014 | Environmental | Open in IMG/M |
| 3300001962 | Marine microbial communities from Cocos Island, Costa Rica - GS023 | Environmental | Open in IMG/M |
| 3300001964 | Marine microbial communities from Rosario Bank, Honduras - GS018 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300001966 | Marine microbial communities from Roca Redonda, Equador - GS030 | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300001972 | Marine microbial communities from the Sargasso Sea - GS000d | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300002186 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002955 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300002965 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
| 3300003476 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2 | Environmental | Open in IMG/M |
| 3300003477 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 | Environmental | Open in IMG/M |
| 3300003500 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003584 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300003645 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 1 | Environmental | Open in IMG/M |
| 3300004276 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m | Environmental | Open in IMG/M |
| 3300004277 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_200m | Environmental | Open in IMG/M |
| 3300005074 | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA | Host-Associated | Open in IMG/M |
| 3300005097 | MiSeq S massa metagenome | Host-Associated | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
| 3300005399 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275 | Environmental | Open in IMG/M |
| 3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
| 3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
| 3300005408 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 | Environmental | Open in IMG/M |
| 3300005422 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV43 | Environmental | Open in IMG/M |
| 3300005424 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV49 | Environmental | Open in IMG/M |
| 3300005426 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005592 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV89 | Environmental | Open in IMG/M |
| 3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005946 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A | Environmental | Open in IMG/M |
| 3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006412 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0125m | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006478 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0125m | Environmental | Open in IMG/M |
| 3300006480 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075m | Environmental | Open in IMG/M |
| 3300006481 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025m | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006843 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_1_0075m | Environmental | Open in IMG/M |
| 3300007041 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', water-ic | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007114 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', waterEBis4 | Environmental | Open in IMG/M |
| 3300007116 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3 | Environmental | Open in IMG/M |
| 3300007144 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', waterEBic1 | Environmental | Open in IMG/M |
| 3300007152 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', waterEBds3 | Environmental | Open in IMG/M |
| 3300007283 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B | Environmental | Open in IMG/M |
| 3300007331 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 DCM_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007332 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007337 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007338 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 DCM_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007340 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 DCM_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007772 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS914_Anemone_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300007957 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0um | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300008624 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 250-2.7um | Environmental | Open in IMG/M |
| 3300008735 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300008954 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009109 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009141 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009375 | Combined Assembly of Gp0137073, Gp0137074 | Environmental | Open in IMG/M |
| 3300009376 | Combined Assembly of Gp0137079, Gp0137080 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011312 | Marine microbial communities from the Deep Pacific Ocean - MP2100 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011330 | Marine microbial communities from the Southern Atlantic ocean - KN S17 Surf_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011331 | Marine microbial communities from the Southern Atlantic ocean - KN S17 Surf_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300012963 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012969 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300013253 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station4_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300014973 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0116 : 2 days incubation | Environmental | Open in IMG/M |
| 3300016729 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016733 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016735 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016758 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071403BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016781 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019009 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966) | Environmental | Open in IMG/M |
| 3300019025 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126) | Environmental | Open in IMG/M |
| 3300019047 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX1399746-ERR1328125) | Environmental | Open in IMG/M |
| 3300019261 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019276 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020237 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291767-ERR318621) | Environmental | Open in IMG/M |
| 3300020266 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951) | Environmental | Open in IMG/M |
| 3300020272 | Marine microbial communities from Tara Oceans - TARA_B100001971 (ERX556120-ERR599127) | Environmental | Open in IMG/M |
| 3300020280 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX556044-ERR599114) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020296 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140) | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020313 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX556055-ERR599061) | Environmental | Open in IMG/M |
| 3300020328 | Marine microbial communities from Tara Oceans - TARA_B100001971 (ERX555937-ERR599015) | Environmental | Open in IMG/M |
| 3300020330 | Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX556097-ERR599147) | Environmental | Open in IMG/M |
| 3300020332 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX555956-ERR598975) | Environmental | Open in IMG/M |
| 3300020334 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555938-ERR599091) | Environmental | Open in IMG/M |
| 3300020359 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555921-ERR599117) | Environmental | Open in IMG/M |
| 3300020361 | Marine microbial communities from Tara Oceans - TARA_B100000071 (ERX556078-ERR599167) | Environmental | Open in IMG/M |
| 3300020370 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020375 | Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX555974-ERR599132) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020383 | Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556043-ERR598971) | Environmental | Open in IMG/M |
| 3300020384 | Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556023-ERR599110) | Environmental | Open in IMG/M |
| 3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020415 | Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020426 | Marine microbial communities from Tara Oceans - TARA_B100000378 (ERX555992-ERR599112) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020432 | Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100) | Environmental | Open in IMG/M |
| 3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020449 | Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020458 | Marine microbial communities from Tara Oceans - TARA_B100000749 (ERX556123-ERR599000) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022843 | Saline water microbial communities from Ace Lake, Antarctica - #5 | Environmental | Open in IMG/M |
| 3300022853 | Saline water microbial communities from Ace Lake, Antarctica - #371 | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300022939 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023245 | Saline water microbial communities from Ace Lake, Antarctica - #423 | Environmental | Open in IMG/M |
| 3300023699 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 81R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024339 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_100_MG | Environmental | Open in IMG/M |
| 3300025265 | Marine microbial communities from the Deep Pacific Ocean - MP2098 (SPAdes) | Environmental | Open in IMG/M |
| 3300025643 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025665 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025700 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026076 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026077 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026083 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026130 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026192 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV89 (SPAdes) | Environmental | Open in IMG/M |
| 3300026199 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV51 (SPAdes) | Environmental | Open in IMG/M |
| 3300026204 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026206 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74 (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
| 3300026260 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes) | Environmental | Open in IMG/M |
| 3300026263 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes) | Environmental | Open in IMG/M |
| 3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
| 3300026279 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes) | Environmental | Open in IMG/M |
| 3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300026447 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027198 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes) | Environmental | Open in IMG/M |
| 3300027234 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027255 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027582 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027702 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027755 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - 250m_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027774 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028132 | Seawater microbial communities from Monterey Bay, California, United States - 61D | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028279 | Seawater microbial communities from Monterey Bay, California, United States - 14D | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean5-_02276280 | 2166559017 | Environmental And Host-Associated | VIKRASLILELNNPKKKLCPKLEKNVNINPKMITFKLKFLNI |
| 2222421649 | 2222084003 | Marine | MLELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| DelMOSum2011_101859682 | 3300000115 | Marine | VIESASLILELNKPRKKLCPKLEKNVNIKPNKITLKFKLL |
| LPaug09P16500mDRAFT_10187653 | 3300000142 | Marine | DSSFLILGLNIPKKKLCPKLEKNVNIKPNITTFKLKLLNILFYDL* |
| LPjun09P1210mDRAFT_10218722 | 3300000168 | Marine | MLELNKPRKKLCPKLEKNVNINPNKITLKFKLLNIGNKIYVL* |
| LPjun08P4500mDRAFT_10151163 | 3300000181 | Marine | LILGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL* |
| LPjun08P4500mDRAFT_10170663 | 3300000181 | Marine | DSSFLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL* |
| LPaug09P26500mDRAFT_10156431 | 3300000247 | Marine | PKKKLCPKLEKNVNIKPNITTFKLKLLNIFFYDL* |
| LP_J_08_P26_500DRAFT_10153651 | 3300000259 | Marine | FLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL* |
| LP_A_09_P20_500DRAFT_10259861 | 3300000260 | Marine | VIDSSFLILGLNIPKKKLCPKLEKNVNIKPNITTFKLKLLNIFFYDL* |
| JGI20151J14362_101156322 | 3300001346 | Pelagic Marine | VIESASLILELNKPRKKLCPKLEKNVKVNPNIITFKLKLLNIENYEL* |
| JGI20151J14362_101615432 | 3300001346 | Pelagic Marine | VIESASLMLELNKPRKKLCPKLEKNVNINPNKITLKFKLLNIGNKIYVL* |
| JGI20160J14292_101191462 | 3300001349 | Pelagic Marine | MESAPLMLELNNPRKKLCPKLEKNVKINPNKITLKFKLLNIGNINYVL* |
| JGI20160J14292_101805471 | 3300001349 | Pelagic Marine | MLELNKPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNRNYEQC |
| JGI20160J14292_101986622 | 3300001349 | Pelagic Marine | VIESASLMLELNSPRKKLCPKLEKNVNINPNKITLKFKLLNIGNR |
| JGI20155J14468_101341682 | 3300001354 | Pelagic Marine | KPRKKLCPKLEKNVKINPNKITLKFKLLNIGNKNNVL* |
| TuiMalila_10197141 | 3300001676 | Black Smokers Hydrothermal Plume | SFLILGLNIPKKKLCPKLEKNVKIKPNIITFKLKLLNIFFYDL* |
| GOS2251_10046582 | 3300001944 | Marine | MLELKSPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL* |
| GOS2251_10352354 | 3300001944 | Marine | MLELKRPKKKLCPKLEKNVKINPNRITLNFKLLNIGNKNYVF* |
| GOS2241_10259852 | 3300001945 | Marine | VIESVSRMLELNKPRKKLCPKLEKNVKINPKIITFKLKLLNIKNYEL* |
| GOS2244_10539544 | 3300001946 | Marine | MDNVSLMLELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNI* |
| GOS2218_10218851 | 3300001947 | Marine | SASLMLELNKPRKKLCPKLEKNVNINPNKIILKFKLLNIGNKIYVL* |
| GOS2231_10301273 | 3300001953 | Marine | ASLILELNKPRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL* |
| GOS2235_10514484 | 3300001954 | Marine | MLELNKPRKKLCPKLEKNVKINPNIITFILKLLNIKNYEL* |
| GOS2237_10000972 | 3300001955 | Marine | ELNNPKKKLCPKLEKNVKINPNIITFKLKLLNIEKNYDL* |
| GOS2247_10272861 | 3300001959 | Marine | LNRPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL* |
| GOS2230_10005815 | 3300001960 | Marine | ESVSLMLELNKPRKKLCPKLEKNVKINPNIITFKLKLLNI* |
| GOS2230_10229943 | 3300001960 | Marine | VIDNASRILELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNILKKL* |
| GOS2230_10462114 | 3300001960 | Marine | VIDNASRMLELKRPRKKLCPKLEKNVNIKPNIITFKLKFLNI* |
| GOS2230_10571992 | 3300001960 | Marine | VIESVSLMLELNKPKKKLCPKLEKNVKINPNIITFKLKLLNI* |
| GOS2239_10209302 | 3300001962 | Marine | MLELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL* |
| GOS2234_10602573 | 3300001964 | Marine | MFELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIFFYDL* |
| GOS2243_10102222 | 3300001965 | Marine | LNNPRKKLCPKLEKNVKINPNRITFKLKLLNIEKNYDL* |
| GOS2243_10158571 | 3300001965 | Marine | MLELNRPRKKLCPKLEKNVKINPNTITFKLKLLNIKNYEL* |
| GOS2243_10811704 | 3300001965 | Marine | MLELNKPKKKLCPKLEKNVKIKPNIITFKLKLLNIKNYEL* |
| GOS2245_10102263 | 3300001966 | Marine | VIDKASLILELNRPRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL* |
| GOS2245_10694771 | 3300001966 | Marine | MLELNKPRKKLCPKLEKNVKINPNIITFKLKLLNMINYEL* |
| GOS2245_10905522 | 3300001966 | Marine | MLVLNKPKKKLCPKLEKNVKINPKIITFKLKLLNIKNYEL* |
| GOS2245_11055731 | 3300001966 | Marine | IESVSLMLELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL* |
| GOS2245_11073703 | 3300001966 | Marine | MLELNKPRKKLCPKLEKNVKINPNKITFKLKLLNIKNYEL* |
| GOS2245_11271913 | 3300001966 | Marine | SLILELNKPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKL* |
| GOS2233_10592425 | 3300001969 | Marine | MLELNKPRKKLCPKLEKNVKINPKIITFKLKLLNIKNYEL* |
| GOS2233_10606102 | 3300001969 | Marine | ELNKPIKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL* |
| GOS2233_11131572 | 3300001969 | Marine | VIDSASRMLELKRPRKKLCPKLEKNVNIKPNIITLKLKLLNILKNYEL* |
| GOS2216_100042654 | 3300001972 | Marine | MESSLRILVLKRPKKKLCPKLEKNVNIKPNTITFKLKLLNILKNYDL* |
| GOS2216_100369903 | 3300001972 | Marine | VPNCPCVIESVSLMLELNKPIKKLCPKHEKNVKINPKIITFKLKFLNI* |
| GOS2246_100214913 | 3300001974 | Marine | MESSLRILVLKSPKKKLCPKLEKNVNIKPNTITFKLKLLNVLKNYDL* |
| GOS2246_101333813 | 3300001974 | Marine | MDNASLMLELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNI* |
| GOS2246_101846251 | 3300001974 | Marine | LILELNRPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL* |
| GOS24894_100150893 | 3300002033 | Marine | MLELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYEL |
| GOS24894_100269575 | 3300002033 | Marine | VIDKASLILELNKPRKKLCPKLEKNVKINPNKITFKLKLLNIKNYDL* |
| GOS24894_101287413 | 3300002033 | Marine | MLELKSPKKKLCPKLEKNVNIKPNIITFKLKLLNIKNYDL |
| GOS24894_101768025 | 3300002033 | Marine | VIDKASLILELNKPRKKLCPKLEKNVKINPNKITFKLKLLNIKNYDL |
| GOS24894_102732732 | 3300002033 | Marine | PNCPWVIKRASLILELNNPKKKLCPKLEKNVNINPKMITFKLKFLNI |
| GOS24894_103336961 | 3300002033 | Marine | ASRILELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYEL |
| GOS24894_105003762 | 3300002033 | Marine | ILELNRPKKKLCPKLEKNVNMNPNIITFKLKLLNI |
| GOScombined01_1001205293 | 3300002040 | Marine | CPCVIDKASLILELNRPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL* |
| GOScombined01_1001713532 | 3300002040 | Marine | VIESVLRILELNKPRKKLCPKLEKNVNIKPNIITFKLKLLNIKNL* |
| GOScombined01_1003043412 | 3300002040 | Marine | MLELNKPRKKLCPKLEKNVKINPKIITFKLKLLNIKKYEL* |
| GOScombined01_1003675801 | 3300002040 | Marine | ILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL* |
| GOScombined01_1007259891 | 3300002040 | Marine | LNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIEKIYDL* |
| GOScombined01_1008874212 | 3300002040 | Marine | PNCPWVIDNSFLILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIEKIYDL* |
| GOScombined01_1015620371 | 3300002040 | Marine | VIESVSLILELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL* |
| GOScombined01_1018066372 | 3300002040 | Marine | MLELKSPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNY |
| GOScombined01_1025077311 | 3300002040 | Marine | RANCPCVIERVSLMLELNSPIKKLCPKHEKNVKIKPKIITFKLKFLNI* |
| GOScombined01_1025922225 | 3300002040 | Marine | LILELKSPKKKLCPKLEKNVNINPNIITFKLKLLNI* |
| GOScombined01_1049377882 | 3300002040 | Marine | ILELNRPKKKLCPKLEKNVNMNPNIITFKLKLLNI* |
| GOScombined01_1051958541 | 3300002040 | Marine | ASRILELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYEL* |
| GOScombined01_1061752152 | 3300002040 | Marine | MLELKSPKKKLCPKLEKNVNIKPNIITFKLKLLNIKNYDL* |
| GOScombined01_1070070503 | 3300002040 | Marine | CIDKASLILELNRPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL* |
| JGI24539J26755_102281271 | 3300002186 | Marine | MLELNNPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNK |
| KVWGV2_102346932 | 3300002242 | Marine Sediment | KKKLCPKLEKNVNINPNIITFKLKLLNILINYDL* |
| JGI26062J44793_10126221 | 3300002955 | Marine | RILELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNILKNYEL* |
| JGI26063J44948_10271792 | 3300002965 | Marine | MDSSFLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL* |
| NAP4_10243831 | 3300003474 | Estuarine | EPNCPCVIDKASLILELNKPRKKLCPKLEKNVKIKPNRITFKLKLLNIDKNYDL* |
| NAP4_10432582 | 3300003474 | Estuarine | ELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNILKNYEL* |
| NAP2_11406692 | 3300003476 | Estuarine | VIESVSRILELNKPRKKLCPKLEKNVNINPNIITFKLKLLNI* |
| nap3_100570062 | 3300003477 | Estuarine | MLGLNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKNYEL* |
| JGI26242J51144_10526642 | 3300003500 | Marine | MLELNKPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNRNYEQCCIYRFRCHGL |
| JGI26254J51713_10950352 | 3300003584 | Marine | LELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKIYVL* |
| NAP1_10290122 | 3300003645 | Estuarine | VIDNASRILELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNILKNYEL* |
| Ga0066610_102933232 | 3300004276 | Marine | ASLMLELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKIYVL* |
| Ga0066610_102988911 | 3300004276 | Marine | LNNPIKKLCPKLEKNVKIKPNKITLKFKLLNIGNINYVL* |
| Ga0066611_101891212 | 3300004277 | Marine | MLELNSPRKKLCPKLEKNVNIKPNKITLIFKLLNIGNRNYVL* |
| Ga0070431_12855601 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | MLELNRPRKKLCPKLEKNVKIKPNIITFKLKLLNIKNYEL* |
| Ga0072505_13976512 | 3300005097 | Marine Benthic Sponge Stylissa Massa Associated | MLVLNIPRKKLCPKLEKNVNINPNTITFKLKLLNIKKYDF* |
| Ga0073579_10129342 | 3300005239 | Marine | IESVSRILELNRPRKKLCPKLEKNVNINPNIITFKLKLLNI* |
| Ga0073579_14490832 | 3300005239 | Marine | MLELNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNKNYE* |
| Ga0066858_100054247 | 3300005398 | Marine | SFLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKFLNIFFYDL* |
| Ga0066858_101068292 | 3300005398 | Marine | ILGLNIPKKKLCPKLEKNVKIKPKKITFKLKLLNIFFYDL* |
| Ga0066860_101816212 | 3300005399 | Marine | MDSSFLILGLNIPKKKLCPKLEKNVKIKPNIITFKLKLLNIFFYDL* |
| Ga0066867_100110657 | 3300005400 | Marine | LGLNIPKKKLCPKLEKNVNIKPNIITFKLKFLNIFFYDL* |
| Ga0066855_101975552 | 3300005402 | Marine | VMDSSFLILGLNIPKKKLCPKLEKNVNIKPNITTFKLKLLNIFYYDL* |
| Ga0066848_100999852 | 3300005408 | Marine | MDSSFLILGLNIPKKKLCPKLEKNVKIKPKKITFKLKLLNIFFYDL* |
| Ga0066848_102261272 | 3300005408 | Marine | MDSSFLILGLNIPKKKLCPKLEKNVKIKPKKITFKLKPLNIFFYDL* |
| Ga0066829_100323791 | 3300005422 | Marine | FLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKFLNIFFYDL* |
| Ga0066829_100335101 | 3300005422 | Marine | MDSSFLILGLNIPKKKLCPKLEKNVKIKPNKITFKLKLLNIINYDL* |
| Ga0066826_102408642 | 3300005424 | Marine | MLGLNIPIKKLCPKLEKNVNMNPNKITFKLKLLNILINYDL* |
| Ga0066847_100065087 | 3300005426 | Marine | SSFLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKFLNIFFYDL* |
| Ga0066866_100251115 | 3300005514 | Marine | PKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL* |
| Ga0066866_100601981 | 3300005514 | Marine | NPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYDL* |
| Ga0066866_101342362 | 3300005514 | Marine | MLELNNPKKKLCPKLEKNVNINPNTITFKLKLLNINKYDL* |
| Ga0066866_102331952 | 3300005514 | Marine | IPKKKLCPKLEKNVKINPNIITFKLNLLNIFYVL* |
| Ga0066862_101076031 | 3300005521 | Marine | GLNIPKKKLCPKLEKNVNINPNIITFKLKFLNIFNYDL* |
| Ga0066862_101958731 | 3300005521 | Marine | LGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL* |
| Ga0066861_100492561 | 3300005522 | Marine | PKKKLCPKLEKNVNINPKIITFKLKLLNIIYYDL* |
| Ga0066861_101847002 | 3300005522 | Marine | MFELNKPKKKLCPKLEKNVKIKPNIITFKLKLLNILKNYEL* |
| Ga0066861_102023551 | 3300005522 | Marine | IPKKKLCPKLEKNVNIKPNITTFKLKFLNIIFYDL* |
| Ga0066865_103325112 | 3300005523 | Marine | IDPNCPWVIESASRILELNRPIKKLCPKLEKNVNINPNIITFKLKLLNI* |
| Ga0066838_100640701 | 3300005592 | Marine | IPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL* |
| Ga0066838_102049551 | 3300005592 | Marine | DSSFLILGLNIPKKKLCPKLEKNVKIKPNKITFKLKLLNIINYDL* |
| Ga0066852_101772912 | 3300005604 | Marine | LNIPKKKLCPKLEKNVKIKPNKITFKLKLLNIIDYDL* |
| Ga0066850_101549401 | 3300005605 | Marine | LGLKIPKKKLCPKLEKNVNMKPNIITFKLKFLNILKYDL* |
| Ga0066835_100968291 | 3300005606 | Marine | NNPRKKLCPKLEKNVNIKPNIITFKLKLLNIEKNYEL* |
| Ga0066835_101356352 | 3300005606 | Marine | MDNASRMLELKRPRKKLCPKLEKNVNINPNIITFKLKLLNILKNYEL* |
| Ga0008649_100429924 | 3300005838 | Marine | RKKLCPKLEKNVNIKPNIITFKLKLLNIYKIYDL* |
| Ga0075119_10711222 | 3300005931 | Saline Lake | LELNSPKKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYE* |
| Ga0066377_102340462 | 3300005934 | Marine | SPKKKLCPKLEKNVNIKPNIITFKLKLLNIKNYDL* |
| Ga0066377_102860272 | 3300005934 | Marine | LELNRPRKKLCPKLEKNVKINPNRITLKLKLLNIKNYDL* |
| Ga0066378_100866211 | 3300005946 | Marine | PIKKLCPKLEKNVKINPNIITFKLKLLNIENYDV* |
| Ga0066378_100951082 | 3300005946 | Marine | MLELKRPRKKLCPKLEKNVNINPNIITFKLKLLNILKNYEL* |
| Ga0066378_101209792 | 3300005946 | Marine | SFLILELKSPKKKLCPKLEKNVNINPNIIAFKLKLLNIKNYDL* |
| Ga0066364_102706461 | 3300005960 | Marine | SRILELKRPKKKLCPKLEKNVNMNPNRITFKLKLLNIKNYEL* |
| Ga0066364_103231951 | 3300005960 | Marine | MLELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILINYEL* |
| Ga0066364_103253762 | 3300005960 | Marine | VIDNASRILELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILKN |
| Ga0066370_100175044 | 3300005971 | Marine | LILVLNNPKKKLCPKLEKNVNIKPNKITFKLKFLNIINDL* |
| Ga0066370_101378312 | 3300005971 | Marine | KRPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYEL* |
| Ga0066370_102411912 | 3300005971 | Marine | VIESVSLMLELNKPKKKLCPKLEKNVKINPNIITLKLKLLNIKNYEL* |
| Ga0066370_102550802 | 3300005971 | Marine | PRKKLCPKLEKNVNIKPNIITFKLKLLNILINYEL* |
| Ga0066370_102728932 | 3300005971 | Marine | FLILELKSPKKKLCPKLEKNVNINPNIITFKLKFLNIKNYDL* |
| Ga0066370_102936052 | 3300005971 | Marine | MLELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL* |
| Ga0066370_103497871 | 3300005971 | Marine | IDNASRMLELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILINYEL* |
| Ga0066375_101287542 | 3300006019 | Marine | MLGLNIPKKKLCPKLEKNVKIKPNIITFKLKLLNIFFYDL* |
| Ga0066371_102861401 | 3300006024 | Marine | LIGALNKPKKKL*PKLEKKVNIKPNKITLKFIFLSI* |
| Ga0075474_102303911 | 3300006025 | Aqueous | VIDKASLILELNNPRKKLCPKLEKNVKINPNKITLKFKLLNIGIKKYE* |
| Ga0075478_100824422 | 3300006026 | Aqueous | MLELNKPRKKLCPKLEKNVKINPNKITLKFKLLNIGINKL* |
| Ga0075462_101778122 | 3300006027 | Aqueous | IEPNCPCVIDKASLILELNRPRKKLCPKLEKNVKIKPNIITFKLKLLNIENYEL* |
| Ga0066836_104514172 | 3300006166 | Marine | KLELKSPRKKLCPKLEKNVNINPNIITFKLKLLNI* |
| Ga0066836_105102951 | 3300006166 | Marine | ELKIPKKKLCPKLEKNVNINPNIITFKLKFLNIFYYDL* |
| Ga0066836_105328731 | 3300006166 | Marine | IPKKKLCPKLEKNVNINPKIITFILNLLNIIYVL* |
| Ga0066836_107493721 | 3300006166 | Marine | LNNPKKKLCPKLEKNVNINPKIITFKLKFLNIIYYDL* |
| Ga0075447_101443072 | 3300006191 | Marine | IESASLMLELNKPRKKLCPKLEKNVNINPNKITLKFKLLNIGNKIYVL* |
| Ga0075445_103018242 | 3300006193 | Marine | VIESASLMLELNSPKKKLCPKLEKNVNIKPNKITLKFKLLNIGNRNYERCCIYR |
| Ga0068470_11319802 | 3300006308 | Marine | MLGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL* |
| Ga0068470_15576422 | 3300006308 | Marine | MLELKIPKKKLCPKLEKNVNIKPNIITFKLKLLNILKYDL* |
| Ga0068471_13560953 | 3300006310 | Marine | LMLVLKIPKKKLCPKLEKNVKINPNIITFKLNLLNIFYVL* |
| Ga0068487_13173461 | 3300006315 | Marine | PCVIDSSFLILVLKIPKKKLCPKLEKNVKINPNIITFKLNLLNIFYVL* |
| Ga0068486_10479001 | 3300006329 | Marine | SLILELNRPRKKLCPKLEKNVKIKPNTITFKLKLLYIEKNYDL* |
| Ga0068486_10851344 | 3300006329 | Marine | MSDDNSSLILELNNPKKKLCPKLEKNVNMNPKIITFKLKLLNI* |
| Ga0068486_12883802 | 3300006329 | Marine | VIESVSLMLELNKPRKKLCPKLEKNVKMNPKIITFKFKLLNIKNYEL* |
| Ga0099675_14680872 | 3300006334 | Marine | VIDNASRMLELKRPRKKLCPKLEKNVNIKPNIITFKLKF* |
| Ga0099675_15731232 | 3300006334 | Marine | VIDNASLMLELNRPRKKLCPKLEKNVNINPNIITFKLKFFNILKIYDL* |
| Ga0099675_16317352 | 3300006334 | Marine | ILELNSPIKKLCPKHEKNVNINPKIITFKLKFLNI* |
| Ga0068495_12879371 | 3300006337 | Marine | LKSPRKKLCPKLEKNVKINPNRITFKLKLLNIENYDL* |
| Ga0068495_15153321 | 3300006337 | Marine | CPWLIDNASLMLELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNILKNYEL* |
| Ga0068495_15832173 | 3300006337 | Marine | ESVSLMLELNKPKKKLCPKLEKNVKIKPNIITFKLKLLNI* |
| Ga0068493_106228572 | 3300006341 | Marine | MDSSFLILGLNIPKKKLCPKLEKNVKIKPNIITFKLKLLYIFFYDL* |
| Ga0099693_15464511 | 3300006345 | Marine | LILELNSPIKKLCPKHEKNVKIKPKIITFKLKLLNI* |
| Ga0099954_10444832 | 3300006350 | Marine | VIDNASRMLELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILINYEL* |
| Ga0075511_12088212 | 3300006402 | Aqueous | VIDKASLILELNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKKYE* |
| Ga0099955_11914101 | 3300006412 | Marine | ILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIFFYDL* |
| Ga0099955_12498382 | 3300006412 | Marine | MLELNIPKKKLCPKLEKNVNINPNIIIFKFKLLNIFAYDL* |
| Ga0099963_12372031 | 3300006413 | Marine | CP*VIESVSLILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL* |
| Ga0075486_10488382 | 3300006425 | Aqueous | P*VIDKASLILELNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKKYE* |
| Ga0100224_11851152 | 3300006478 | Marine | VIDNASRMLELKRPRKKLCPKLEKNVKMKPNKITFILKLLNIKNYDL* |
| Ga0100226_11231552 | 3300006480 | Marine | MLELKRPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL* |
| Ga0100226_14587412 | 3300006480 | Marine | VPNCPCVIESVSLMLELNKPIKKLCPKHEKNVKMNPKIITFKLKLLNI* |
| Ga0100226_16148191 | 3300006480 | Marine | TLGLNKPIKKLCPKLEKNVKINPNIITFKLKLLNIENYDL* |
| Ga0100229_15039682 | 3300006481 | Marine | MLELNKPIKKLCPKHEKNVKMNPKIITFKLKLLNILINYNL* |
| Ga0100228_13937262 | 3300006565 | Marine | ELNRPRKKLCPKLEKNVKINPNTITFKLKLLNIFKL*LVMSLS* |
| Ga0068496_1416712 | 3300006843 | Marine | MLELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYEL* |
| Ga0101669_1069282 | 3300007041 | Volcanic Co2 Seep | NRPRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL* |
| Ga0101669_1073571 | 3300007041 | Volcanic Co2 Seep | NRPRKKLCPKLEKNVKINPNTITFKLKLLNIENNYDL* |
| Ga0075110_11095721 | 3300007074 | Saline Lake | MESASLILELKSPKKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYEQ |
| Ga0101668_11409841 | 3300007114 | Volcanic Co2 Seep Seawater | ELNKPKKKLCPKLEKNVKIKPNIITFKLKLLNIKNYEL* |
| Ga0101667_10493562 | 3300007116 | Volcanic Co2 Seep Seawater | VSLILVLNIPRKKLCPKLEKNVNINPNTITFKLKFLNIKKYDF* |
| Ga0101670_10289662 | 3300007144 | Volcanic Co2 Seep | VIDKASLILELNRPRKKLCPKLEKNVKIKPNIITFKLKLLNIKNYEL* |
| Ga0101672_10828462 | 3300007152 | Volcanic Co2 Seeps | LELNNPKKKLCPKLEKNVNMNPNRITFKLKLLNIKNYEL* |
| Ga0066366_101256371 | 3300007283 | Marine | LILGLNIPKKKLCPKLEKNVNIKPNITTFKLKFLNIFFYDL* |
| Ga0079271_13317122 | 3300007331 | Marine | VPNCPWEIERASLILELNNPKKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL* |
| Ga0079256_10122303 | 3300007332 | Marine | ILELNKPRKKLCPKLEKNVNINPNTITFKLKFLNIKKYDF* |
| Ga0079244_13379221 | 3300007337 | Marine | SVSLILVLNIPRKKLCPKLEKNVNINPNTITFKLKFLNIKKYDF* |
| Ga0079242_13464362 | 3300007338 | Marine | SVSLILELNKPKKKLCPKLEKNVNIKPNIITFKLKLLNILKNYDL* |
| Ga0079242_13800292 | 3300007338 | Marine | IPKKKLCPKLEKNVNIKPNITTFKLKFLNIFFYDL* |
| Ga0079241_12965901 | 3300007340 | Marine | RKKLCPKLEKNVKINPNIITFKLKLLNILKNYDL* |
| Ga0102820_11192101 | 3300007554 | Estuarine | SAPLMLELNNPRKKLCPKLEKNVKINPNKITLKFKLLNIGNKNYVL* |
| Ga0102821_10737802 | 3300007557 | Estuarine | MLELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKIYVL* |
| Ga0102863_11938702 | 3300007622 | Estuarine | MLGLNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKNYEL* |
| Ga0102948_10428863 | 3300007623 | Water | IDKASLILELNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIIKL* |
| Ga0102901_10602931 | 3300007634 | Estuarine | MLELNNPRKKLCPKLEKNVNINPNKITLKFKLLNIGNRNYEQCCIYRFR |
| Ga0102902_12169082 | 3300007644 | Estuarine | SLILELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNMGIKNYEL* |
| Ga0102824_10398991 | 3300007681 | Estuarine | RKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYVL* |
| Ga0102823_11723882 | 3300007692 | Estuarine | VMESASLMLELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKIYVL* |
| Ga0105672_10862711 | 3300007772 | Diffuse Vent Fluid, Hydrothermal Vents | PKKKPCPKLEKNVNIKPNITTFKLKLLNILFYDL* |
| Ga0105739_11264741 | 3300007954 | Estuary Water | LELNNPRKKLCPKLEKNVKINPNKITLKFKLLNIGNINYVL* |
| Ga0105741_11014062 | 3300007956 | Estuary Water | IDRASLILELNNPRKKLCPKLEKNVNIKPNIITFKLKLLNI* |
| Ga0105742_10656532 | 3300007957 | Estuary Water | MESASLILELNSPKKKLCPKLEKNVKIKPNKITLKFKLLNMGIKNYEL* |
| Ga0111541_101086491 | 3300008097 | Marine | NCPCVIESVSLILELNSPIKKLCPKHEKNVKIKPKIITFKLKLLNI* |
| Ga0111541_101176172 | 3300008097 | Marine | VIDNSFLMLELKIPKKKLCPKLEKNVNINPNIITFKLKLLNIIKYEL* |
| Ga0111541_101466211 | 3300008097 | Marine | LNNPKKKLCPKLEKNVNIKPNKITFKLKFLNIINDL* |
| Ga0115652_10873951 | 3300008624 | Marine | PWLINSSFLMFGLNIPKKKLCPKLEKNVNIKPNTIIFKFKLLNIFIYVV* |
| Ga0115657_11739972 | 3300008735 | Marine | MLGLKIPKKKLCPKLEKNVNMKPNIITFKLKLLNILKYDL* |
| Ga0115650_12232671 | 3300008954 | Marine | LNIPKKKLCPKLEKNVNINPNTIIFKFKLLNIFIYVV* |
| Ga0102963_14400202 | 3300009001 | Pond Water | PRKKLCPKLEKNVKINPNKVTLKFKLLNIGNINYVL* |
| Ga0102957_10412862 | 3300009027 | Pond Water | MLELNKPRKKLCPKLEKNVKINPNKITLKFKLLNIGIKKYE* |
| Ga0102860_12619812 | 3300009056 | Estuarine | VIESASLMLELNSPRKKLCPKLEKNVNINPNKITLKFKLLNIGNINYVL* |
| Ga0115566_100279817 | 3300009071 | Pelagic Marine | MLELNRPRKKLCPKLEKNVNINPNIITFKLKLLNIEKIYDL* |
| Ga0115566_105006722 | 3300009071 | Pelagic Marine | LVLNNPKKKLCPKLEKNVNINPNIITFKLKLLNILKYVL* |
| Ga0115566_106224512 | 3300009071 | Pelagic Marine | ELNSPKKKLCPKLEKNVNINPNRITLKFKLLNIGIINYVL* |
| Ga0115552_13164652 | 3300009077 | Pelagic Marine | MLELNKPRKKLCPKLEKNVKINPNKITLKFKLLNIGNKNNVL* |
| Ga0102814_106172892 | 3300009079 | Estuarine | MLGLNSPRKKLCPKLEKNVKINPNKITLKFKLLNIGIKNYEL* |
| Ga0102812_107579702 | 3300009086 | Estuarine | LNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKIYVL* |
| Ga0117922_10200147 | 3300009109 | Marine | MPNCPWLIDSSFLMLELNKPKKKLCPKLEKNVNINPNIIILKFKLLNIFIYEL* |
| Ga0117922_11539211 | 3300009109 | Marine | SSFLILGLNIPIKKLCPKLEKNVKIKPNKITFKLKLLNIINYDL* |
| Ga0118729_10342621 | 3300009130 | Marine | LNNPRKKLCPKLEKNVKINPNIITFKLKLLNIENYEL* |
| Ga0102884_11925481 | 3300009141 | Estuarine | PWVMESASLILELNNPKKKLCPKLEKNVNINPNKITLKFKLLNIGNKIYVL* |
| Ga0114995_106477881 | 3300009172 | Marine | MLELNKPKKKLCPKLEKNVNINPNKITLKFKLLNIGNIIY |
| Ga0114995_107939811 | 3300009172 | Marine | MLELNNPKKKLCPKLEKNVNIKPNKITLKFKLLNIGN |
| Ga0114996_112318621 | 3300009173 | Marine | PIKKLCPKQEKNVNINPNKITFKLKFLNIKNYDL* |
| Ga0118721_11267511 | 3300009375 | Marine | LMLGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL* |
| Ga0118722_10557807 | 3300009376 | Marine | ELKIPKKKLCPKLEKNVNINPNIITFKLKFLNIFIYDL* |
| Ga0118722_13367581 | 3300009376 | Marine | ELKRPIKKLCPKLEKNVKINPKIITLKFNLILNIVNL* |
| Ga0114994_104719562 | 3300009420 | Marine | MLELNIPKKKLCPKLEKNVNINPNKITLKFKLLNIGNRNYEQCC |
| Ga0114994_105746462 | 3300009420 | Marine | LKRPKKKLCPKLEKNVNINPNKITLKFKLLNIGINNYE* |
| Ga0114994_106028212 | 3300009420 | Marine | MESASLMLELNNPRKKLCPKLEKNVNINPNKITLKFKLLNIGNKIYVL* |
| Ga0114994_106622191 | 3300009420 | Marine | LMLELNSPKKKLCPKLEKNVKIKPNKITLKFKLLNIGNKKL* |
| Ga0114994_110332202 | 3300009420 | Marine | MLALNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGN |
| Ga0114998_104777061 | 3300009422 | Marine | MLELNNPRKKLCPKLEKNVNINPNKITLKFKLLNIGNRNY |
| Ga0114997_101329622 | 3300009425 | Marine | MLELNKPRKKLCPKLEKNVNIKPNNITLKFKLLNIGKKNYE* |
| Ga0114997_101512252 | 3300009425 | Marine | MDRVSLMLALNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNKDYE* |
| Ga0114997_103094682 | 3300009425 | Marine | LGLKRPKKKLCPKLEKNVNINPNKITLKFKLLNIGINNYE* |
| Ga0114997_104828801 | 3300009425 | Marine | VIERDSLILELKRPKKKLCPKLEKNVNINPNKITLKFKLLNIGNYNYE* |
| Ga0114997_106155941 | 3300009425 | Marine | LILGLNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNIKYVL* |
| Ga0115547_11557342 | 3300009426 | Pelagic Marine | MESASLILELNNPKKKLCPKLEKNVNINPNKITLKFKLLNIGNKIYVL* |
| Ga0115005_109004881 | 3300009432 | Marine | MIELNNLRKKLYPKLEKNVNIKPYKITLKFKLLNIGNRNYEQC |
| Ga0115556_11424402 | 3300009437 | Pelagic Marine | CEIDNASLILELNSPRKKLCPKLEKNVNIKPNIITFKLKFLNILKNYDL* |
| Ga0115556_11557542 | 3300009437 | Pelagic Marine | PRKKLCPKLEKNVNINPNKITLKFKLLNIGNINYVL* |
| Ga0115560_13385601 | 3300009447 | Pelagic Marine | MLELNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNINYVL* |
| Ga0115554_12170601 | 3300009472 | Pelagic Marine | NCPCVIDNASLILELNSPRKKLCPKLEKNVNINPNIITFKLKLLNILKNYDL* |
| Ga0115554_12292281 | 3300009472 | Pelagic Marine | MLELNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIG |
| Ga0114932_100660461 | 3300009481 | Deep Subsurface | LILELNKPRKKLCPKLEKNVKIKPNRITFKLKLLNIDNNYDL* |
| Ga0114932_101789453 | 3300009481 | Deep Subsurface | MLELNKPKKKLCPKLEKNVNINPNIIILKFKLLNIFIYEL* |
| Ga0114932_102992742 | 3300009481 | Deep Subsurface | LKIPKKKLCPKLEKNVNINPNIIIFKLKFLNIFIYVL* |
| Ga0115571_12860192 | 3300009495 | Pelagic Marine | VIESASLMLELNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNKIYVL* |
| Ga0115569_104685911 | 3300009497 | Pelagic Marine | MLGLNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKNY |
| Ga0115569_105211451 | 3300009497 | Pelagic Marine | RKKLCPKLEKNVKIKPNKITLKFKLLNIGIKNYEL* |
| Ga0115568_103317821 | 3300009498 | Pelagic Marine | MLELNNPKKKLCPKLEKNVKIKPNKITLKFKFLYIGTKNYE* |
| Ga0115567_103781422 | 3300009508 | Pelagic Marine | NSPRKKLCPKLEKNVKIKPNKITLKFKFLYIGTKNYE* |
| Ga0115567_105516082 | 3300009508 | Pelagic Marine | IESVSRMLGLNSPRKKLCPKLEKNVKINPNTITLKFKLLNIGNINYVL* |
| Ga0115003_105375862 | 3300009512 | Marine | MLELNNPRKKLCPKLEKNVNINPNKITLKFKLLNIGNRN |
| Ga0115006_112025672 | 3300009544 | Marine | LELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYVL* |
| Ga0115011_101593383 | 3300009593 | Marine | ASLILELNKPRKKLCPKLEKNVKINPNRITFKLKLLNIDKNYDL* |
| Ga0115011_106266452 | 3300009593 | Marine | VLKIPKKKLCPKLEKNVKINPNIITFKLNLLNIFYVL* |
| Ga0115011_106619191 | 3300009593 | Marine | LELKSPRKKLCPKLEKNVKIKPNTITFKLKLLNIEINYDL* |
| Ga0115011_112088272 | 3300009593 | Marine | ELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIEKNYEL* |
| Ga0114933_102992903 | 3300009703 | Deep Subsurface | ELNNPKKKLCPKLEKNVNMKPKIITFKLKLLNIILYDL* |
| Ga0114933_103220152 | 3300009703 | Deep Subsurface | DKASLILELNKPRKKLCPKLEKNVKIKPNRITFKLKLLNIDKNYDL* |
| Ga0114933_103614302 | 3300009703 | Deep Subsurface | LNKPIKKLCPKLEKNVKIKPNKITFKLKLLNIINNDL* |
| Ga0114933_108113311 | 3300009703 | Deep Subsurface | MLELNRPRKKLCPKLEKNVNIKPNIITFKLKLLNI |
| Ga0114933_109239272 | 3300009703 | Deep Subsurface | IPKKKLCPKLEKNVKIKPNIITFKLKLLNIFFYDL* |
| Ga0114933_109579591 | 3300009703 | Deep Subsurface | LKIPKKKLCPKLEKNVNIKPNTITFKLKFLNILKYDL* |
| Ga0114933_110195791 | 3300009703 | Deep Subsurface | PKKKLCPKLEKNVNIKPNIIIFKFKLLNIFIYDL* |
| Ga0115000_103168511 | 3300009705 | Marine | WVIDNSVLMLKLNNPKKKLCPKLEKNVNMKPNKITFKLKLFNILNYV* |
| Ga0115000_103460431 | 3300009705 | Marine | NKPRKKLCPKLEKNVNIKPNNITLKFKLLNIGKKNYE* |
| Ga0115001_101106381 | 3300009785 | Marine | MLELNNPRKKLCPKLEKNVNINPNKITLKFKLLNIGNRNYEQCCIYRF |
| Ga0115001_106644531 | 3300009785 | Marine | MLELNSPKKKLCPKLEKNVKIKPNKITLKFKLLNIGNKKL* |
| Ga0115001_109978382 | 3300009785 | Marine | MLELNNPKKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYEQ |
| Ga0114999_109475451 | 3300009786 | Marine | MLELNNPRKKLCPKLEKNVNINPNKITLKFKLLNIGDRN |
| Ga0115012_108068781 | 3300009790 | Marine | PRKKLCPKLEKNVNINPNTITFKLKLLNIEKNYDL* |
| Ga0115012_113771643 | 3300009790 | Marine | CPCVIDKASLILELNKPRKKLCPKLEKNVKINPNTITFKLKLLNIEKL* |
| Ga0115012_115351811 | 3300009790 | Marine | IESVSLMLELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIENYEL* |
| Ga0129345_11708061 | 3300010297 | Freshwater To Marine Saline Gradient | IEPNCPCVIDNASLMLELNKPRKKLCPKLEKNVKINPNKITLKFKLLNIGINKL* |
| Ga0129342_11419392 | 3300010299 | Freshwater To Marine Saline Gradient | PWVIDNSFLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIEKIYDL* |
| Ga0129342_12743862 | 3300010299 | Freshwater To Marine Saline Gradient | ELNNPKKKLCPKLEKNVKINPNKITLKFKLLNIGIIKL* |
| Ga0133547_107017251 | 3300010883 | Marine | MLELNKPKKKLCPKLEKNVNINPNKITLKFKLLNIGNKNYEQCCIY |
| Ga0133547_107962173 | 3300010883 | Marine | MLELNNPRKKLCPKLEKNVNINPNKITLKFKLLNIG |
| Ga0133547_108185353 | 3300010883 | Marine | MLELNKPRKKLCPKLEKNVKINPNKITLKFKLLNIGNIIYE |
| Ga0133547_113932231 | 3300010883 | Marine | MLELNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNRNYEQCCIYR |
| Ga0114934_102624431 | 3300011013 | Deep Subsurface | LIL*FNKPRKKLCPKLEKNVKINPNRITFKLKLLNIDKNYDF* |
| Ga0138349_11117331 | 3300011312 | Deep Ocean | MLGLKIPIKKLCPKLEKNVNINPNTITFKLKLLNIFKL* |
| Ga0138383_12196441 | 3300011330 | Marine | SASRMLELNNPRKKLCPKLEKKVKIKPNKITFILKLLNIKYYDL* |
| Ga0138384_10700481 | 3300011331 | Marine | SLILVLNIPRKKLCPKLEKNVNIKPNTITFKLKFLNIKKYDF* |
| Ga0129344_10659951 | 3300012520 | Aqueous | RMLELNRPRKKLCPKLEKNVNIKPNIITFKLKLLNI* |
| Ga0160422_100210757 | 3300012919 | Seawater | PCVIDNSSLMLGLNKPKKKLCPKLEKNVKINPNKITFKLKLLNIIYDL* |
| Ga0160422_103854051 | 3300012919 | Seawater | ELKRPRKKLCPKLEKNVNINPNIITFKLKLLNILINYEL* |
| Ga0160422_105058151 | 3300012919 | Seawater | PRKKLCPKLEKNVKIKPNKITFILKLLNIKNYDL* |
| Ga0163110_102710073 | 3300012928 | Surface Seawater | LNNPKKKLCPKLEKNVKIKPNTITFKLKLLNIEKL* |
| Ga0163110_103918491 | 3300012928 | Surface Seawater | NNPRKKLCPKLEKNVKINPNRITFKLKFLNIEKKL* |
| Ga0163110_104225432 | 3300012928 | Surface Seawater | CVIESVSLMLELNKPIKKLCPKHEKNVKINPKIITFKLKFLNI* |
| Ga0163110_110230992 | 3300012928 | Surface Seawater | MLELNNPRKKLCPKLEKNVNINPNEITFKLKLLNIEKKL* |
| Ga0163110_111323481 | 3300012928 | Surface Seawater | MLELNNPRKKLCPKLEKNVKINPNKITFKLKLLNIKKL* |
| Ga0163110_115801671 | 3300012928 | Surface Seawater | IEPNCPCVIDKASLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIKNYEL* |
| Ga0163110_117765411 | 3300012928 | Surface Seawater | LSLNNPKKKLCPKLEKNVNINPKIITLILKFFNIKLCLVT* |
| Ga0163109_107916632 | 3300012936 | Surface Seawater | LILELNNPKKKLCPKLEKNVKINPNIITFKLKFLNIEKNYDL* |
| Ga0163109_108715122 | 3300012936 | Surface Seawater | VPNCPWVIDNASRMLELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYEL* |
| Ga0163108_106261291 | 3300012950 | Seawater | CVMDSSFLILGLNIPKKKLCPKLEKNVKIKPKKIIFILKLLNIFFYDL* |
| Ga0163108_111164612 | 3300012950 | Seawater | LGLKIPIKKLCPKLEKNVNINPNTITFKLKLLNIFKL* |
| Ga0163180_112701572 | 3300012952 | Seawater | EPNCPCDIESSDLMLLLNNPIKKLCPKLEKNVNIKPNKITFKLKLLNIFFYDL* |
| Ga0163180_113295031 | 3300012952 | Seawater | SVSLILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL* |
| Ga0163179_101735673 | 3300012953 | Seawater | ILELNNPRKKLCPKLEKNVNINPNIITFKLKLLNILINYDL* |
| Ga0163179_107212632 | 3300012953 | Seawater | FLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIKYYEL* |
| Ga0163179_115266322 | 3300012953 | Seawater | NRPRKKLCPKLEKNVKINANIITFKFKILNIEKNYDL* |
| Ga0163179_118293703 | 3300012953 | Seawater | MDSSFLILELNNPKKKLCPKLEKNVNINPKIITFKLKLLNII |
| Ga0163111_101206191 | 3300012954 | Surface Seawater | KPIKKLCPKQEKNVKIKPKIITFKFKPLNILKNYDL* |
| Ga0163111_125956642 | 3300012954 | Surface Seawater | SLMLELNNPRKKLCPKLEKNVKIKPNIITFKLKLLNIKNYEL* |
| Ga0129340_10104663 | 3300012963 | Aqueous | PRKKLCPKLEKNVNINPNIITFKLKLLNIKKIYDL* |
| Ga0129340_12055441 | 3300012963 | Aqueous | MLELNKPRKKLCPKLEKNVKIKPNKITLKFKLLNIGINKL* |
| Ga0129343_10315832 | 3300012967 | Aqueous | VIDNSFLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIEKIYDL* |
| Ga0129332_11602442 | 3300012969 | Aqueous | DRASLILELNNPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYDL* |
| Ga0129327_106146932 | 3300013010 | Freshwater To Marine Saline Gradient | LELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIEKIYDL* |
| Ga0116834_10532242 | 3300013188 | Marine | VIESVSRILGLNNPRKKLCPKLEKNVNMNPKIITFKLKLLNI* |
| Ga0116834_10732642 | 3300013188 | Marine | LMLELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL* |
| Ga0116813_10572831 | 3300013253 | Marine | ELNRPRKKLCPKLEKNVKINPKINTFKLKPLNIKNYDL* |
| Ga0134293_10126641 | 3300014973 | Marine | RMLGLNSTRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKN* |
| Ga0182056_10860832 | 3300016729 | Salt Marsh | ELNNPRKKLCPKLEKNVKMKPNTITFKLKLLNIEKNYDF |
| Ga0182042_13544311 | 3300016733 | Salt Marsh | PRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDF |
| Ga0182074_10380671 | 3300016735 | Salt Marsh | LILELNRPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| Ga0182070_13017871 | 3300016758 | Salt Marsh | ILELNRPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| Ga0182082_15178131 | 3300016771 | Salt Marsh | NNPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDF |
| Ga0182063_11881562 | 3300016781 | Salt Marsh | VIDKASLMLELNNPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| Ga0182063_16026481 | 3300016781 | Salt Marsh | WVIDKASLMLELNNPRKKLCPKLEKNVKMKPNTITFKLKLLNIEKNYDF |
| Ga0182095_15667672 | 3300016791 | Salt Marsh | MLELNRPRKKLCPKLEKNVKINPNKITLNFKLLNIGNKNYVL |
| Ga0180120_103408121 | 3300017697 | Freshwater To Marine Saline Gradient | RKKLCPKLEKNVKIKPNKITLKFKLLNMGIKNYEL |
| Ga0181412_11252281 | 3300017714 | Seawater | MLELNKPRKKLCPKLEKNVKINPNRITLNFKLLNIGNKNYVL |
| Ga0181417_10674871 | 3300017730 | Seawater | MLELNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKNYEL |
| Ga0181417_10805351 | 3300017730 | Seawater | NXPWLIDKVSLMLELNNPKKKLCPKLEKNVNIKPNIITLKLKLLNIEKKLXVVMLLS |
| Ga0181416_10675131 | 3300017731 | Seawater | ILELNKPRKKLCPKLEKNVKINPNTITFKLKLLNIDKNYDL |
| Ga0187222_11106672 | 3300017734 | Seawater | IEPNCPXVIESVSLILELNKPRKKLCPKLEKNVNINPNIITFKFKLLNILKNYEL |
| Ga0187222_11202752 | 3300017734 | Seawater | CPXVIESVSLMLELNKPRKKLCPKLEKNVKIKPNKITFKLKLLNIKNYEL |
| Ga0181427_10961981 | 3300017745 | Seawater | VIDKASLILELNRPKKKLCPKLEKNVKIKPNKSTFKLKLLNI |
| Ga0181400_11619092 | 3300017752 | Seawater | IESVSRMLELNRPRKKLCPKLEKNVNINPNIITFKLKLLNI |
| Ga0181400_12152941 | 3300017752 | Seawater | MLELNSPKKKLCPKLEKNVNIKPNKITLKFKLLNIGNKN |
| Ga0181411_11677272 | 3300017755 | Seawater | VSLMLELNNPRKKLCPKLEKNVKINPNRITLNFKLLNIGNKNYVL |
| Ga0181382_10701942 | 3300017756 | Seawater | DKASLILELNIPRKKLCPKLEKNVKIKPNKITFKLKLLNIKNYEL |
| Ga0181413_10727552 | 3300017765 | Seawater | MLELNRPRKKLCPKLEKNVNIKPNIITFKLKLLNIKL |
| Ga0181406_11590851 | 3300017767 | Seawater | RPRKKLCPKLEKNVNIKPNIITFKLKLLNIEKNYEL |
| Ga0181425_11442181 | 3300017771 | Seawater | SVSLILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNI |
| Ga0181386_11866632 | 3300017773 | Seawater | LELNKPKKKLCPKLEKNVNMNPNTITFKLKLLNIKNYEL |
| Ga0181394_10701292 | 3300017776 | Seawater | VIESASLILELNSPRKKLCPKLEKNVNIKPNKITLIFKLLNIGNRNYVL |
| Ga0181394_11917501 | 3300017776 | Seawater | IDPNCPXDIESVSLILELNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNINYVL |
| Ga0181423_10793692 | 3300017781 | Seawater | MLGLNSPRKKLCPKLEKNVKIKPNKITLKFKLFNIGIKNYEL |
| Ga0181380_12909752 | 3300017782 | Seawater | ILELNNPKKKLCPKLEKNVKINPNRITLNFKLLNIGNKNYVL |
| Ga0181424_100923593 | 3300017786 | Seawater | PCVIERASLILELNKPRKKLCPKLEKNVNINPNKITLKFKLLNIGNINYVL |
| Ga0181424_101449021 | 3300017786 | Seawater | VSRILELNNPRKKLCPKLEKNVNINPNIITFKLKFLNI |
| Ga0181424_104461302 | 3300017786 | Seawater | SLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNI |
| Ga0181565_104572902 | 3300017818 | Salt Marsh | DKASLILELNSPRKKLCPKLEKNVKINPNKITLKFKLLNIGKN |
| Ga0181584_105865752 | 3300017949 | Salt Marsh | SLRMLGLNKPIKKLCPKQEKNVNINPYKITFLFKLR |
| Ga0181584_105915791 | 3300017949 | Salt Marsh | MDNSFLILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| Ga0181607_101606931 | 3300017950 | Salt Marsh | ESVSLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIENYEL |
| Ga0181607_105853841 | 3300017950 | Salt Marsh | LNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIKKL |
| Ga0181581_106021361 | 3300017962 | Salt Marsh | PXVIESVSLMLELNKPKKKLCPKLEKNVKIKPNIITFKLKLLNIKNYEL |
| Ga0181585_102031863 | 3300017969 | Salt Marsh | VSLILELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIEKNYDL |
| Ga0181576_103844461 | 3300017985 | Salt Marsh | NCPXEIERVSLILELNKPKKKLCPKLEKNVKIKPNIITFKLKLLNIDKKLXLVMLLS |
| Ga0181600_103749071 | 3300018036 | Salt Marsh | ELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIENYEL |
| Ga0181600_103936152 | 3300018036 | Salt Marsh | VIDKVSLILELNKPRKKLCPKLEKNVKINPKIITFKLKLLNIKNYEL |
| Ga0181572_106463051 | 3300018049 | Salt Marsh | ASLMLELNNPRKKLCPKLEKNVKMKPNTITFKLKLLNIEKKL |
| Ga0181559_105907811 | 3300018415 | Salt Marsh | PCVIDNASLMLELNKPRKKLCPKLEKNVKINPNKITLKFKLLNIGINKLXVMLLL |
| Ga0181553_104324261 | 3300018416 | Salt Marsh | WVIDNSFLILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIEKIYDL |
| Ga0181567_109684802 | 3300018418 | Salt Marsh | LNRPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| Ga0181563_104685921 | 3300018420 | Salt Marsh | LMLELNNPRKKLCPKLEKNVKMKPNTITFKLKLLNIEKKL |
| Ga0181591_111979442 | 3300018424 | Salt Marsh | MLELNNPRKKLCPKLEKNVKMKPNTITFKLKLLNIEKKL |
| Ga0181566_102756902 | 3300018426 | Salt Marsh | MLELNKPKKKLCPKLEKNVKIKPNIITFKLKLLNIDKNYDL |
| Ga0192880_100909612 | 3300019009 | Marine | MLELNKPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNINYVL |
| Ga0193545_101279713 | 3300019025 | Marine | FMLELKSPRKKLCPKLEKNVKINPNIITFKLKLLNIEKNYDL |
| Ga0193549_100506023 | 3300019047 | Marine | PCVIDKASLILELNKPRKKLCPKLEKNVKIKPNRITFKLKLLNIDKNYDL |
| Ga0182097_15067372 | 3300019261 | Salt Marsh | MLELNKPRKKLCPKLEKNVKINPNKITLKFKLLNIGINKL |
| Ga0182067_15195162 | 3300019276 | Salt Marsh | AYNEPNXPWVIDKASLMLELNNPRKKLCPKLEKNVKMKPNTITFKLKLLNIEKNYDF |
| Ga0182058_11986652 | 3300019283 | Salt Marsh | MEPNCPWVIESVSRILGLNNPRKKLCPKLEKNVNMNPKIITFKLKLLNI |
| Ga0181562_102678461 | 3300019459 | Salt Marsh | NSFLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIERIYDL |
| Ga0194024_10250352 | 3300019765 | Freshwater | VIDKASLILELNNPRKKLCPKLEKNVKINPNKITLKFKLLNIGIKKYE |
| Ga0181555_10972451 | 3300020051 | Salt Marsh | RPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| Ga0181595_101741712 | 3300020053 | Salt Marsh | PCVIDNASLMLELNKPRKKLCPKLEKNVKINPNKITLKFKLLNIGINKL |
| Ga0181597_102532772 | 3300020194 | Salt Marsh | SLILELNKPRKKLCPKLEKNVKINPKTITFKLKLLNIKNYEL |
| Ga0181597_104600801 | 3300020194 | Salt Marsh | LILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIENYEL |
| Ga0181570_100485565 | 3300020207 | Salt Marsh | VSRILGLNNPRKKLCPKLEKNVNMNPKIITFKLKLLNI |
| Ga0181570_102745091 | 3300020207 | Salt Marsh | IERSSLILELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIEKNYDL |
| Ga0211478_1007282 | 3300020237 | Marine | MLELNRPRKKLCPKLEKNVKINPNRITFKLKLLNIDKNYDF |
| Ga0211478_1022312 | 3300020237 | Marine | SLILELNSPIKKLCPKHEKNVKIKPKIITFKLKLLNI |
| Ga0211519_10343351 | 3300020266 | Marine | LMLELKSPRKKLCPKLEKNVNINPNTITFKLKLLNIEKNYDL |
| Ga0211566_10540742 | 3300020272 | Marine | MLGLKIPIKKLCPKLEKNVNINPNTITFKLKLLNIFKL |
| Ga0211591_10353473 | 3300020280 | Marine | SLILELKRPRKKLCPKLEKNVKINPNKITFKLKFLNIKKNDL |
| Ga0211591_10587981 | 3300020280 | Marine | CVIDKASLILELNRPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| Ga0211483_100796362 | 3300020281 | Marine | VSLILVLNIPRKKLCPKLEKNVNINPNTITFKLKFLNIKKYDF |
| Ga0211483_100901661 | 3300020281 | Marine | IESVSRILELNKPRKKLCPKLEKNVKINPKIITFKLKLLNI |
| Ga0211474_10567131 | 3300020296 | Marine | CVIESVSLILVLNIPRKKLCPKLEKNVNINPNTITFKLKFLNINKYDF |
| Ga0211542_10412171 | 3300020312 | Marine | NKPIKKLCPKLEKNVKINPNIITFKLKLLNIENYDV |
| Ga0211485_10223921 | 3300020313 | Marine | PRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL |
| Ga0211567_10407712 | 3300020328 | Marine | FLILGLNIPKKKLCPKLEKNVKIRPNKITFKLKLLNIINYDL |
| Ga0211572_11055251 | 3300020330 | Marine | CPCVMDSSFLILGLNIPKKKLCPKLEKNVKIKPKKITFILKLLNIFFYDL |
| Ga0211502_11130241 | 3300020332 | Marine | NVSLMLELKSPRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL |
| Ga0211593_10172992 | 3300020334 | Marine | MDNVSRMLELKRPRKKLCPKLEKNVNINPNIITFKLKLLNILKNYEL |
| Ga0211610_11141031 | 3300020359 | Marine | VPNCPWLIFKSDRISELNNPIKKLCPKLEKNVNINPKKI |
| Ga0211531_11486332 | 3300020361 | Marine | FLILGLNIPKKKLCPKLEKNVKIKPNKITFKLKLLNIIDYDL |
| Ga0211672_102095292 | 3300020370 | Marine | NKPKKKLCPKLEKNVKINPNIITFKLKLLNIFFYDL |
| Ga0211672_102287261 | 3300020370 | Marine | FLMLELNIPKKKLCPKLEKNVNIKPNIITFKLKLLNILNYDL |
| Ga0211672_102883192 | 3300020370 | Marine | KPRKKLCPKLEKNVKIKPKIITFKLKFLNIKNYDL |
| Ga0211477_102443341 | 3300020374 | Marine | LMLELKRPRKKLCPKLEKNVNINPNIITFKLKLLNILKNYEL |
| Ga0211656_100969822 | 3300020375 | Marine | NCPCVMDSSFLILGLNIPKKKLCPKLEKNVKIKPNKITFKLKLLNIIDYDL |
| Ga0211682_102948222 | 3300020376 | Marine | MLELNKPKKKLCPKLEKNVNINPNKITLKFKLLNIGNIIYEQCCIYR |
| Ga0211686_103569802 | 3300020382 | Marine | MLELNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNKN |
| Ga0211686_104509032 | 3300020382 | Marine | MLELNKPRKKLCPKLEKNVNINPNKITLKFKLLNIGNII |
| Ga0211646_103058712 | 3300020383 | Marine | CPXVMDSSFLILGLNIPKKKLCPKLEKNVKIKPKKITFKLKLLNIFFYDL |
| Ga0211596_101284952 | 3300020384 | Marine | ELKRPKKKLCPKLEKNVNMNPNRITFKLKLLNIKNYEL |
| Ga0211675_101038223 | 3300020391 | Marine | SVSLILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| Ga0211675_102477612 | 3300020391 | Marine | KRPRKKLCPKLEKNVNINPNIITFKLKLLNILKNYEL |
| Ga0211675_104484331 | 3300020391 | Marine | LMLELKRPRKKLCPKLEKNVKIKPNRITFKLKLLNIDKNYDF |
| Ga0211705_103091392 | 3300020395 | Marine | DNASRMLELKRPRKKLCPKLEKNVNINPNIITFKLKLLNILKNYEL |
| Ga0211705_103138942 | 3300020395 | Marine | LGLKIPKKKLCPKLEKNVNINPKIITFILNLLNIIYVL |
| Ga0211687_100650601 | 3300020396 | Marine | EAYIDPNCPCVIESVSRILELNRPRKKLCPKLEKNVNINPNIITFKLKLLNI |
| Ga0211583_101971312 | 3300020397 | Marine | ILVLNIPRKKLCPKLEKNVNIKPNTITFKLKFLNIKKYDF |
| Ga0211636_102798721 | 3300020400 | Marine | PKKKLCPKLEKNVNINPNRITFKLKFLNITLCLVM |
| Ga0211499_102182492 | 3300020402 | Marine | NKPKKKLCPKLEKNVNIKPNRITFKLKFLNITLCLVM |
| Ga0211472_100759311 | 3300020409 | Marine | LMLELKSPKKKLCPKLEKNVNMNPNKITFKLKFLNI |
| Ga0211587_102359252 | 3300020411 | Marine | VSRILELNKPRKKLCPKLEKNVKMKPNIITFKLKLLNILKKNEL |
| Ga0211516_101758622 | 3300020413 | Marine | MLGLNKPKKKLCPKLEKNVNINPNKITLKLKLLNI |
| Ga0211516_104542752 | 3300020413 | Marine | MLELNSPKKKLCPKLEKNVNIKPNIITFKLKLLNIDKNYEL |
| Ga0211553_103195672 | 3300020415 | Marine | LNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL |
| Ga0211644_102026431 | 3300020416 | Marine | DPNCPCVIESVSRILELNKPRKKLCPKLEKNVNIKPNIITFKLKLLNI |
| Ga0211644_102596131 | 3300020416 | Marine | KVSLMLELKSPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| Ga0211528_102785022 | 3300020417 | Marine | MLELNKPIKKLCPKHEKNVKINPKIITFKLKFLNIYIFYDL |
| Ga0211557_101043873 | 3300020418 | Marine | IESASRMFELNKPKKKLCPKLEKNVNINPNIITFKLKLLNILINYDL |
| Ga0211557_101692901 | 3300020418 | Marine | IESASRMFELNKPKKKLCPKLEKNVKIKPNIITFKLKLLNILKNYEL |
| Ga0211557_101713211 | 3300020418 | Marine | PNCPXVIESSFLILELKSPKKKLCPKLEKNVNINPNIITFKLKLLNIKNYDL |
| Ga0211512_100924853 | 3300020419 | Marine | KASLILELNKPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| Ga0211512_103729702 | 3300020419 | Marine | MLELNSPRKKLCPKLEKNVNIKPNIITFKLKLLNIDKNYEL |
| Ga0211653_102412162 | 3300020421 | Marine | SLILELNRPRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL |
| Ga0211620_102264431 | 3300020424 | Marine | LELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNILKNYEL |
| Ga0211536_101655411 | 3300020426 | Marine | EPNCPXLIESVSLMLELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| Ga0211521_102681881 | 3300020428 | Marine | SSDLMLLLNNPIKKLCPKLEKNVNIKPNKITFKLKLLNIFFYDL |
| Ga0211581_101731582 | 3300020429 | Marine | LILVLNIPRKKLCPKLEKNVNINPNTITFKLKFLNIKKYDF |
| Ga0211622_101821532 | 3300020430 | Marine | MDPNCPWVIERVSLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIKNYEL |
| Ga0211622_102993391 | 3300020430 | Marine | RILELNRPRKKLCPKLEKNVNIKPKIITFKFKLLNI |
| Ga0211556_101505021 | 3300020432 | Marine | FLILELKIPIKKLCPKLEKNVNMKPNIITFKLKFLNIFIYEL |
| Ga0211556_102006642 | 3300020432 | Marine | MESVSLILELNKPRKKLCPKLEKNVKIKPNTITFKLKLLNIKNYEL |
| Ga0211565_100730083 | 3300020433 | Marine | ELKRPRKKLCPKLEKNVNIKPNIITLKLKLLNILKNYEL |
| Ga0211708_101273571 | 3300020436 | Marine | LMLVLNIPRKKLCPKLEKNVNINPNKITFKLKLLNINK |
| Ga0211539_103973002 | 3300020437 | Marine | DKASRILELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNILKNYEL |
| Ga0211558_102565511 | 3300020439 | Marine | DNASRMLELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILINYEL |
| Ga0211518_103752872 | 3300020440 | Marine | NCPWVIDKASLILELNIPRKKLCPKLEKNVKINPNRITFKLKLLNIDKNYDF |
| Ga0211559_103579981 | 3300020442 | Marine | SVSRILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| Ga0211564_102599781 | 3300020445 | Marine | LELKIPKKKLCPKLEKNVNIKPNIITFKLKFLNIFIYEL |
| Ga0211564_106076851 | 3300020445 | Marine | CPCVIERTSLILSLNNPKKKLCPKLEKNVNINPNIITFKLKFLNI |
| Ga0211574_101550692 | 3300020446 | Marine | IDKASLILELNRPRKKLCPKLEKNVKINPNTITFILKLLNIEKNYDL |
| Ga0211574_102904441 | 3300020446 | Marine | LLNKPKKKLCPKLEKNVNIKPNRITFKLKFLNITLCLVM |
| Ga0211638_103832952 | 3300020448 | Marine | SRILELNRPRKKLCPKLEKNVNINPNKITFKLKLLNI |
| Ga0211638_106060591 | 3300020448 | Marine | ILELNSPRKKLCPKLEKNVKINPNSITFKLKLLNI |
| Ga0211642_100356771 | 3300020449 | Marine | LMLGLKIPIKKLCPKLEKNVNINPNRITFKLKLLNILIIHDL |
| Ga0211642_101123183 | 3300020449 | Marine | ILGLNIPKKKLCPKLEKNVKIKPNKITFKLKLLNIIDYDL |
| Ga0211642_101699371 | 3300020449 | Marine | FLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL |
| Ga0211642_101849211 | 3300020449 | Marine | LMLGLKIPIKKLCPKLEKNVNINPNTITFKLKLLNIFKL |
| Ga0211641_104394781 | 3300020450 | Marine | DNVSRMLELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNI |
| Ga0211473_103495201 | 3300020451 | Marine | PNCPCVIDKASLILELNKPRKKLCPKLEKNVKINPNTITFKLKLLNIDKNYDL |
| Ga0211550_102356391 | 3300020453 | Marine | SVSLILLLNKPKKKLCPKLEKNVKINPNIITLILKLLNIFKKL |
| Ga0211548_100952301 | 3300020454 | Marine | SVSRMLELNRPRKKLCPKLEKNVNINPNIITFKLKLLNI |
| Ga0211548_104719572 | 3300020454 | Marine | VPNCPCVIESVSLMLELNSPIKKLCPKHEKNVKIKPKKITLKLKLLNI |
| Ga0211664_101196023 | 3300020455 | Marine | LMLGLKIPKKKLCPKLEKNVNMKPNKITFKLKLLNILKYDL |
| Ga0211664_104456302 | 3300020455 | Marine | LMLGLKIPKKKLCPKLEKNVNMKPNIITFKLKLLNILKYDL |
| Ga0211551_101658001 | 3300020456 | Marine | XVIDNSFLILELNNPKKKLCPKLEKNVNMNPKIITFKLKLLNII |
| Ga0211551_105029011 | 3300020456 | Marine | DNSFLILELNNPKKKLCPKLEKNVNINPNIITFKLKFLNIIL |
| Ga0211697_101480651 | 3300020458 | Marine | MDSSFLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL |
| Ga0211514_103087502 | 3300020459 | Marine | ILELNNPKKKLCPKLEKNVNINPKIITFKLKLLNIIYYDL |
| Ga0211514_104256622 | 3300020459 | Marine | LILSLNNPKKKLCPKLEKNVNINPNIITFKLKFLNILINYDL |
| Ga0211486_101932262 | 3300020460 | Marine | SVSLILVLNIPRKKLCPKLEKNVNINPNTITFKLKFLNIKKYDF |
| Ga0211535_103127442 | 3300020461 | Marine | CPWVIFKSFLILELNKPKKKLCPKLEKNVKMKPNNITFKLNL |
| Ga0211535_103515792 | 3300020461 | Marine | PNCPCVIESVSLILELNKPKKKLCPKLEKNVNIKPNIITFKLKLLNILKNYDL |
| Ga0211535_104744251 | 3300020461 | Marine | ILELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIVNYEL |
| Ga0211676_102193463 | 3300020463 | Marine | IDKASLILELNKPRKKLCPKLEKNVKIKPNRITFKLKLLNIDKNYDL |
| Ga0211676_106143381 | 3300020463 | Marine | NCPCVIDKASLILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| Ga0211694_104137091 | 3300020464 | Marine | IPKKKLCPKLEKNVKINPNIITFKLKFLNILFYEL |
| Ga0211640_100572831 | 3300020465 | Marine | ELNRPRKKLCPKLEKNVNIKPNIITLKLKFLNIKKIYDL |
| Ga0211640_101758081 | 3300020465 | Marine | NCPCVIDKSFLMLELKIPKKKLCPKLEKNVKINPNIITFKLKFLNILFYEL |
| Ga0211640_102152913 | 3300020465 | Marine | PKKKLCPKLEKNVKIKPNIITFKLKLLNILKNYEL |
| Ga0211640_105286371 | 3300020465 | Marine | VSLMLELNKPKKKLCPKLEKNVKIKPNTITFKLKLLNIKNYEL |
| Ga0211640_106035131 | 3300020465 | Marine | ASLILELNKPRKKLCPKLEKNVKINPNRITFKLKLLNIKNYEL |
| Ga0211714_102786701 | 3300020466 | Marine | TLGLNKPIKKLCPKLEKNVKINPNIITFKLKLLNIENYDV |
| Ga0211713_106800542 | 3300020467 | Marine | MLELKIPKKKLCPKLEKNVKINPNIITFKLKLLNMFYDL |
| Ga0211475_100644824 | 3300020468 | Marine | ESVSLMLELNNPRKKLCPKLEKNVKINPNIITFKLKLLNIYNYEL |
| Ga0211475_104076581 | 3300020468 | Marine | SLILELNSPRKKLCPKLEKNVKIKPNIITFKLKLLNIYRKL |
| Ga0211577_102531733 | 3300020469 | Marine | LMLELNNPKKKLCPKLEKNVNIKPNIITFKLKLLNIEKNYEL |
| Ga0211577_106917012 | 3300020469 | Marine | VIERVPRILELNRPKKKLCPKLEKNVNINPNIITFKLK |
| Ga0211614_101314052 | 3300020471 | Marine | MDNVSRMLELKRPRKKLCPKLEKNVNINPNIITFKLKLLNILKYDL |
| Ga0211614_101953432 | 3300020471 | Marine | VIDNASRMLELKRPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYDL |
| Ga0211579_107516332 | 3300020472 | Marine | NSFLILELNNPKKKLCPKLEKNVNINPKIITFKLKLLNIIYYDL |
| Ga0211625_102703781 | 3300020473 | Marine | SRMLELNKPKKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| Ga0211625_104190052 | 3300020473 | Marine | SPXVIDNSFLILELNNPKKKLCPKLEKNVNIKPKIITFELKLLNIILYDL |
| Ga0211547_106196251 | 3300020474 | Marine | LILELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIDKNYDL |
| Ga0211541_100454941 | 3300020475 | Marine | ILELNKPRKKLCPKLEKNVNINPNIITFKLKFLNIKKNYDL |
| Ga0211585_101220721 | 3300020477 | Marine | NSFLMLGLKIPKKKLCPKLEKNVNIKPNIITFKLKLLNILKYDL |
| Ga0211585_103561492 | 3300020477 | Marine | FLILELNNPKKKLCPKLEKNVNINPKIITFKLKLLNII |
| Ga0211585_103785772 | 3300020477 | Marine | LELNNPKKKLCPKLEKNVNMNPKIITFKLKLLNII |
| Ga0211503_105642362 | 3300020478 | Marine | LKIPKKKLCPKLEKNVKINPNIITFKLNLLNIFYVL |
| Ga0206687_11505372 | 3300021169 | Seawater | MLELNKPKKKLCPKLEKNVKINPNRITLNFKLLNMGNKNYVL |
| Ga0213862_102276842 | 3300021347 | Seawater | PCVTERVSRMLELNRPKKKLCPKLEKNVNIKPNIITLKLKLLNI |
| Ga0213860_104022262 | 3300021368 | Seawater | NKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| Ga0213869_102033541 | 3300021375 | Seawater | SLMLELNNPKKKLCPKLEKNVNINPNIITFKLKLLNI |
| Ga0213869_102044191 | 3300021375 | Seawater | LILELNKPRKKLCPKLEKNVNINPNIITFKLKLLNIEKIYDL |
| Ga0213869_102555741 | 3300021375 | Seawater | CPCVIDNASLMFELNKPRKKLCPKLEKNVKINPNKITLKFKLLNIGINKLXVMLLL |
| Ga0213869_104188492 | 3300021375 | Seawater | MDPNXPWVMESASLMLELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGKKNYE |
| Ga0222717_106722772 | 3300021957 | Estuarine Water | MLELNNPKKKLCPKLEKNVKIKPNKITLKFKFLYIGTKNYE |
| Ga0224906_10642121 | 3300022074 | Seawater | CPWVIESVSLMLELNNPKKKLCPKLEKNVNIKPNIITFKLKFLNI |
| Ga0224906_10984792 | 3300022074 | Seawater | PWVMESVSRILELNRPRKKLCPKLEKNVNINPNIITFKLKLLNI |
| Ga0187833_106062611 | 3300022225 | Seawater | MLGLKIPIKKLCPKLEKNVNINPNTITFKLKLLNIFK |
| Ga0222631_10265922 | 3300022843 | Saline Water | LMLELNSPKKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYE |
| Ga0222652_10282412 | 3300022853 | Saline Water | MESASLMLELNSPKKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYE |
| Ga0255755_12899411 | 3300022909 | Salt Marsh | DNSFLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIERIYDL |
| (restricted) Ga0233426_102802922 | 3300022920 | Seawater | PNCPCVIESASLILELNNPRKKLCPKLEKNVKIKPNKITLKLKLLNIGNINYVL |
| Ga0255773_103486242 | 3300022925 | Salt Marsh | PXLIDKASLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIERIYDL |
| Ga0255758_102321461 | 3300022928 | Salt Marsh | LELNNPRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL |
| (restricted) Ga0233433_103998431 | 3300022931 | Seawater | MLELNKPRKKLCPKLEKNVNINPNKITLKFKLLNIGNKIYVL |
| Ga0255754_104164991 | 3300022939 | Salt Marsh | LNNPRKKLCPKLEKNVKMKPNTITFKLKLLNIEKKL |
| Ga0255782_102354301 | 3300023105 | Salt Marsh | IESVSRILGLNNPRKKLCPKLEKNVNMNPKIITFKLKLLNI |
| (restricted) Ga0233432_104478102 | 3300023109 | Seawater | SVSRILELNRPRKKLCPKLEKNVNIKPNIITFKLKLLNI |
| Ga0255751_103825882 | 3300023116 | Salt Marsh | LELNNPRKKLCPKLEKNVKMKPNTITFKLKLLNIEKNYDF |
| Ga0255766_102731491 | 3300023172 | Salt Marsh | KPRKKLCPKLEKNVKIKPNIITFKLKLLNIERIYDL |
| Ga0222655_10205201 | 3300023245 | Saline Water | PKKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYE |
| Ga0228695_10237762 | 3300023699 | Seawater | MLGLNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKNYEL |
| Ga0233451_103842252 | 3300024301 | Salt Marsh | RVSLILELKSPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| (restricted) Ga0233445_10615173 | 3300024339 | Seawater | PWVIESASLMLELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKIYVL |
| Ga0208467_10422021 | 3300025265 | Deep Ocean | IPKKKLCPKLEKNVKIKPKKITFILKLLNIFFYDL |
| Ga0209151_11249631 | 3300025643 | Marine | SLMLELNSPRKKLCPKLEKNVNIKPNKITLIFKLLNIGNKNYVL |
| Ga0208428_10591201 | 3300025653 | Aqueous | CPWVMDNSFLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIEKIYDL |
| Ga0209360_11200672 | 3300025665 | Marine | ILELNNPRKKLCPKLEKNVKINPNKITLKFKLLNIGNINYVL |
| Ga0209306_11950171 | 3300025680 | Pelagic Marine | EPNCPCEIDNASLILELNSPRKKLCPKLEKNVNIKPNIITFKLKFLNILKNYDL |
| Ga0209095_10524801 | 3300025685 | Pelagic Marine | PNCPCEIDNASLILELNSPRKKLCPKLEKNVNIKPNIITFKLKFLNILKNYDL |
| Ga0209095_11632262 | 3300025685 | Pelagic Marine | SLILELNSPRKKLCPKLEKNVNINPNIITFKLKLLNILKNYDL |
| Ga0209505_10979562 | 3300025690 | Pelagic Marine | DPNCPCVIERASLILELNKPRKKLCPKLEKNVNINPNKITLKFKLLNIGNINYVL |
| Ga0209406_11519542 | 3300025694 | Pelagic Marine | ASLILELNKPRKKLCPKLEKNVKINPNKIILKFKLLNIGNIKYVL |
| Ga0209661_11250292 | 3300025700 | Marine | ESVSLILELNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNINYVL |
| Ga0209119_13148362 | 3300025860 | Pelagic Marine | MLELNSPRKKLCPKLEKNVNINPNKITLKFKLLNIGNRN |
| Ga0209666_13588922 | 3300025870 | Marine | MNPNXPCVIESASLMLELNSPRKKLCPKLEKNVNINPNKITLK |
| Ga0209632_102416671 | 3300025886 | Pelagic Marine | RKKLCPKLEKNVNIKPNKITLKFKLLNIGNKIYVL |
| Ga0209631_100821221 | 3300025890 | Pelagic Marine | NCPWVIESASLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIENYEL |
| Ga0209631_104027592 | 3300025890 | Pelagic Marine | ASLILELNSPKKKLCPKLEKNVKINPNKITLNFMLLNIGNNNYVL |
| Ga0209630_101610311 | 3300025892 | Pelagic Marine | PCEIESVSRMLELNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKNYEL |
| Ga0209630_103034511 | 3300025892 | Pelagic Marine | LILELNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKKYE |
| Ga0209630_103297942 | 3300025892 | Pelagic Marine | MESAPLMLELNNPRKKLCPKLEKNVKINPNKITLKFKLLNIGNINYVL |
| Ga0209335_103016122 | 3300025894 | Pelagic Marine | NKPRKKLCPKLEKNVKIKPNIITFKLKLLNIENYEL |
| Ga0209425_101729813 | 3300025897 | Pelagic Marine | VSRMLELNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKNYEL |
| Ga0208261_10777402 | 3300026076 | Marine | IESVSLILELNNPKKKLCPKLEKNVNIKPNIITFKLKLLNILKNYDL |
| Ga0208261_11002861 | 3300026076 | Marine | EPNCPCDIESASRMFELNKPKKKLCPKLEKNVKIKPNIITFKLKLLNILKNYEL |
| Ga0208749_10754211 | 3300026077 | Marine | ASLILELNRPRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL |
| Ga0208749_10965941 | 3300026077 | Marine | GLNIPKKKLCPKLEKNVNIKPNITTFKLKFLNIFFYDL |
| Ga0208878_10585041 | 3300026083 | Marine | ILVLNIPRKKLCPKLEKNVNINPNTITFKLKFLNIKKYDF |
| Ga0208878_10972982 | 3300026083 | Marine | KRPRKKLCPKLEKNVNIKPNIITFKLKLLNILINYEL |
| Ga0209961_10364431 | 3300026130 | Water | IEPNCPXVIDKASLILELNNPRKKLCPKLEKNVKINPNKITLKFKLLNIGIKKYE |
| Ga0209932_10657581 | 3300026183 | Pond Water | ILELNNPRKKLCPKLEKNVKINPNKITLKFKLLNIGIKKYE |
| Ga0209932_10880451 | 3300026183 | Pond Water | ILELNKPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIIKL |
| Ga0207986_10269811 | 3300026192 | Marine | DSSFLILGLNIPKKKLCPKLEKNVKIKPNKITFKLKLLNIINYDL |
| Ga0208638_10247044 | 3300026199 | Marine | VIDSSFLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKFLNIFFYDL |
| Ga0208521_10090571 | 3300026204 | Marine | SFLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKFLNIFFYDL |
| Ga0207988_10067717 | 3300026206 | Marine | FLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKFLNIFFYDL |
| Ga0208407_11229791 | 3300026257 | Marine | IDSSFLILGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIKKIYDL |
| Ga0208130_10886252 | 3300026258 | Marine | ESVSRILELNRPRKKLCPKLEKNVNIKPNIITFKLKLLNI |
| Ga0208408_10109006 | 3300026260 | Marine | IPKKKLCPKLEKNVNIKPNIITFKLKFLNIFFYDL |
| Ga0207992_10764202 | 3300026263 | Marine | ILELKIPKKKLCPKLEKNVNINPNIITFKLKFLNIFNYDL |
| Ga0207993_10884252 | 3300026270 | Marine | NKPRKKLCPKLEKNVKINPNIITFKLKLLNIKKYEL |
| Ga0207993_11579442 | 3300026270 | Marine | CPXVIESVSLILELNRPRKKLCPKLEKNVKINPNRITLKLKLLNIKNYDL |
| Ga0208411_10416763 | 3300026279 | Marine | LGLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL |
| Ga0208411_11915621 | 3300026279 | Marine | VIESVSLMLGLKIPIKKLCPKLEKNVNINPNRITF |
| Ga0208277_11905822 | 3300026292 | Marine | IILELNNPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| Ga0208277_12598481 | 3300026292 | Marine | LNMPKKKLCPKLEKNVNIKPNTIIFKFKLLNIYIYVL |
| Ga0208764_100532254 | 3300026321 | Marine | LNIPRKKLCPKLEKNVNMKPNIITFKLKFLNIFFYDL |
| Ga0208764_101481193 | 3300026321 | Marine | SFLILGLKIPKKKLCPKLEKNVKIKPNIITFKLKLLNIFFYDL |
| Ga0208764_101665682 | 3300026321 | Marine | MLELNNPKKKLCPKLEKNVNINPNTITFKLKLLNI |
| Ga0208764_105428161 | 3300026321 | Marine | NCPWLIESMSRMLELNKPKKKLCPKLEKNVNIKPNIITFKLKLLNIKKIYDL |
| Ga0247607_10324712 | 3300026447 | Seawater | MERASLILELNNPRKKLCPKLEKNVNIKPNIITFKLKLLNI |
| Ga0208163_10449362 | 3300027198 | Estuarine | ASLMLELNKPRKKLCPKLEKNVNINPNKITLKFKLLNIGNKIYVL |
| Ga0208170_10798292 | 3300027234 | Estuarine | MLELNKPRKKLCPKLEKNVNIKPNKITLKFKLLNIGN |
| Ga0208681_10804101 | 3300027255 | Estuarine | MLELNKPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNRNYE |
| Ga0208971_10482443 | 3300027582 | Marine | VIESASLMLELNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNKIYVL |
| Ga0209710_12651281 | 3300027687 | Marine | MLELNSPRKKLCPKLEKNVNINPNKITLKFKLLNIGNKN |
| Ga0209710_12865481 | 3300027687 | Marine | MLGLNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNRNYEQ |
| Ga0209036_10315341 | 3300027702 | Marine | IDKVSLMLELNNPRKKLCPKLEKNVNIKPNIITFKLKLLNIEKNYEL |
| Ga0209036_11776182 | 3300027702 | Marine | LGLNIPKKKLCPKLEKNVNINPNITTFKLKFLNIFFYDL |
| Ga0208304_101661521 | 3300027751 | Estuarine | LMLELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKIYVL |
| Ga0209034_102685282 | 3300027755 | Marine | ILELNKPRKKLCPKLEKNVKINPNRITFKLKLLNIDKNYDL |
| Ga0209433_102647512 | 3300027774 | Marine | ILELNNPRKKLCPKLEKNVKIKPNTITFKLKILNIIKL |
| Ga0209709_100253107 | 3300027779 | Marine | MDRDSLILELKRPKKKLCPKLEKNVNINPNKIILKFKLLNIGNYNYE |
| Ga0209709_100630851 | 3300027779 | Marine | NNPRKKLCPKLEKNVKIKPNKIILKFKLLNIGNKNYVL |
| Ga0209709_102551561 | 3300027779 | Marine | NKPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNINYV |
| Ga0209830_100723774 | 3300027791 | Marine | CVIESASLMLELNKPRKKLCPKLEKNVNINPNKITLKFKLLNIGNKIYVL |
| Ga0209091_104417072 | 3300027801 | Marine | MLELNKPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYEQC |
| Ga0209091_105069701 | 3300027801 | Marine | LNNPIKKLCPKLEKNVNINPNKITFKLKLLNIKNYDL |
| Ga0209090_102020682 | 3300027813 | Marine | ILISELNNPIKKLCPKLEKNVNINPNIIILKLNLMLNI |
| Ga0209090_102443772 | 3300027813 | Marine | ILGLNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNKDYE |
| Ga0209090_103202731 | 3300027813 | Marine | IEPNXPXVIERESLILGLNKPRKKLCPKLEKNVKIKPNKITLKFKLLNIGN |
| Ga0209035_106472162 | 3300027827 | Marine | MKSASLILGLNKPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNKNNVL |
| Ga0209359_100320671 | 3300027830 | Marine | PRKKLCPKLEKNVNIKPNRITFKFKILNIEKNYDL |
| Ga0209359_102232482 | 3300027830 | Marine | ESSFLILELKSPKKKLCPKLEKNVNINPNIITFKLKLLNIKNYDL |
| Ga0209359_104783831 | 3300027830 | Marine | VALILVLNSPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYDL |
| Ga0209359_104832711 | 3300027830 | Marine | LILELNRPKKKLCPKLEKNVKINPNKSTFKLKLLNI |
| Ga0209402_106308531 | 3300027847 | Marine | IPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDL |
| Ga0209404_103677781 | 3300027906 | Marine | NCPCEIDKASLILELNRPRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL |
| Ga0228649_10431161 | 3300028132 | Seawater | NKPKKKLCPKLEKNVKINPNTITFKLKLLNIKNYEL |
| Ga0228608_10714732 | 3300028136 | Seawater | RILELNRPRKKLCPKLEKNVNIKPNIITFKLKLLNI |
| Ga0257106_12496802 | 3300028194 | Marine | PRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKNYEL |
| Ga0257114_11685451 | 3300028196 | Marine | MLELNSPKKKLCPKLEKNVNIKPNKITLKFKLLNIGNKIYVL |
| Ga0257114_12161181 | 3300028196 | Marine | ESASLMLELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKIYVL |
| Ga0257114_13231411 | 3300028196 | Marine | MLELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYEQC |
| Ga0228613_10885351 | 3300028279 | Seawater | LNSPRKKLCPKLEKNVKIKPNKITLKFKLLNIGIKNYEL |
| Ga0257126_11147851 | 3300028287 | Marine | IDPNCPCDIESVSLILELNNPRKKLCPKLEKNVKIKPNKITLKFKLLNIGNINYVL |
| Ga0257112_103126912 | 3300028489 | Marine | IPKKKLCPKLEKNVNIKPNIITFKLKLINILKYDL |
| Ga0257111_10968761 | 3300028535 | Marine | GLNIPKKKLCPKLEKNVNIKPNIITFKLKLLNIFFYDF |
| Ga0308025_12035591 | 3300031143 | Marine | MLVLKRPKKKLCPKLEKNVNINPNKITLKLKLLKIG |
| Ga0308025_12808811 | 3300031143 | Marine | MLELNKPKKKLCPKLEKNVNINPNKITLKFKLLNIGNI |
| Ga0308010_11389042 | 3300031510 | Marine | FVLNNPIKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYE |
| Ga0307488_107157201 | 3300031519 | Sackhole Brine | MLELNNPKKKLCPKLEKNVNIKPNKITLKFKLLNIGNRNYEQC |
| Ga0308019_103256991 | 3300031598 | Marine | MLELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNK |
| Ga0308004_100305904 | 3300031630 | Marine | ESASLMLELNSPKKKLCPKLEKNVNINPNKIILKFKLLNIGNKIYVL |
| Ga0308001_103314821 | 3300031644 | Marine | MERASLIVELNKPRKKLCPKLEKNVNINPNKITLKFKLLNIGNIIYEQCC |
| Ga0307986_103803752 | 3300031659 | Marine | MLELNSPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNKDY |
| Ga0308016_103675322 | 3300031695 | Marine | ILELNNPRKKLCPKLEKNVKINPNKIILKFKLLNIGKIDYVL |
| Ga0308013_101752442 | 3300031721 | Marine | MESASLILELNNPRKKLCPKLEKNVNIKPNKITLKFKLLNIGNINYVL |
| Ga0308013_101829721 | 3300031721 | Marine | GLNNPKKKLCPKLEKNVNIKPNKITLKFKLLNIGNKNYEQC |
| Ga0315328_104084482 | 3300031757 | Seawater | LELNNPKKKLCPKLEKNVNINPKIITFKLKLLNII |
| Ga0315326_109323281 | 3300031775 | Seawater | NCPWVIESISRMLELNKPKKKLCPKLEKNVNIKPNIITFKLKLLNIKNL |
| Ga0310343_100952124 | 3300031785 | Seawater | NCPWVIDNSFLILELNNPKKKLCPKLEKNVKINPNKITLKLKLLNIKNNDL |
| Ga0310343_103264641 | 3300031785 | Seawater | KRPRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL |
| Ga0310343_107825371 | 3300031785 | Seawater | NCPWVMDNVSLMLELKRPRKKLCPKLEKNVNMKPNIITFKLKLLNI |
| Ga0310343_112366952 | 3300031785 | Seawater | EIFKVSLTLGLNKPIKKLCPKLEKNVKINPNIITFKLKLLNIENYDV |
| Ga0315320_109971751 | 3300031851 | Seawater | NCPXDIESVSLMLELNNPRKKLCPKLEKNVKINPNKITLKFKLLNIGNINYVL |
| Ga0315318_104985072 | 3300031886 | Seawater | LGLNIPKKKLCPKLEKNVKIKPNIITFKLKLLNIFFYDL |
| Ga0310344_111290162 | 3300032006 | Seawater | NCPXLIDSSFLMLGLKIPKKKLCPKLEKNVNMKPNIITFKLKLLNILKYDL |
| Ga0310344_112330132 | 3300032006 | Seawater | IDNSFLMLGLKIPKKKLCPKLEKNVNIKPNIITFKLKFLNILKYDL |
| Ga0315316_104442772 | 3300032011 | Seawater | NCPXVIESVSRMLELNRPRKKLCPKLEKNVKINPNIITFKLKLLNIKKYEL |
| Ga0315316_106493012 | 3300032011 | Seawater | SVSLILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNI |
| Ga0315316_108585682 | 3300032011 | Seawater | VIDRASLILELNNPRKKLCPKLEKNVNIKPNIITFKLKLLNILKNYDL |
| Ga0315316_109206212 | 3300032011 | Seawater | ILELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIYKIYDL |
| Ga0315316_114214132 | 3300032011 | Seawater | VIESVSRMLELNRPRKKLCPKLEKNVNIKPNIITFKLKLLNI |
| Ga0315327_101814663 | 3300032032 | Seawater | ILVLKIPKKKLCPKLEKNVKINPNIITFKLNLLNIFYVL |
| Ga0315327_103806232 | 3300032032 | Seawater | SSFLILVLNIPKKKLCPKLEKNVKINPNIITFKLNLLNIFYVL |
| Ga0315330_104747722 | 3300032047 | Seawater | ASRMLELNRPRKKLCPKLEKNVKINPNTITFKLKLLNIKNYEL |
| Ga0315315_102220014 | 3300032073 | Seawater | HVSRTLGLNSPRKKLCPKLEKNVKMKPNIITLKFKLLNIGLKNYEL |
| Ga0315315_103047793 | 3300032073 | Seawater | ELNRPKKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| Ga0315315_108969542 | 3300032073 | Seawater | IDNASLILELNKPRKKLCPKLEKNVKIKPNTITFKLKLLNIEKNYDL |
| Ga0315315_110099771 | 3300032073 | Seawater | MLELNNPRKKLCPKLEKNVNIKPNIITFKLKLLNIEKFYD |
| Ga0315315_114799311 | 3300032073 | Seawater | ESVSLMLELNKPRKKLCPKLEKNVKIKPNIITFKLKLLNIINYEL |
| Ga0315321_107302922 | 3300032088 | Seawater | ILELNNPRTKLCPKLEKNVKIKPNKITLKLKLLNIGNINYVL |
| Ga0310342_1011978672 | 3300032820 | Seawater | IESVSLMLELNKPRKKLCPKLEKNVKINPNIITFKLKLLNIKNYEL |
| Ga0310342_1020949751 | 3300032820 | Seawater | WVIESVSRMLELNNPRKKLCPKLEKNVNMNPNIITFKLKFLII |
| Ga0310342_1028271321 | 3300032820 | Seawater | LELNRPRKKLCPKLEKNVKINPNTITFKLKLLNIEKNYDL |
| ⦗Top⦘ |