Protein Family IF13964
Metagenome
Isolate
209
Members
130
Samples
132
Scaffolds
394.65
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8067987626|8067988605|
- Length
- 443 aa
- Sequence
- MRREQERGVRHDVSIPAVRDAPPDYAGSMASRKVFGIVLAGGEGKRLMPLTEDRAKPAVPFGGQYRLIDFALSNLLNSGLRQIVVLTQYKSHSLDRHVSQTWRLSGLLNSYVASVPAQQRLGKRWFSGSADAILQSLNLIYDEKPDIIVVVGADHVYRMDFSQMIDAHVASGAEATVAAIRQPISLANQFGVIDVDPKRPDRIRQFLEKPNDPVGLPDSPDEVFASMGNYVFDADALVDSVLRDGEQTSSSHDMGGDIIPSFVARGAAGVYDLQRNDVPGATDRDRYYWRDVGTLDSYYEAHQDLISVLPVFNLYNREWPIFSQQLNSPPAKVTRDARGALGTVIDSIVSLGSVISGAHIERSVLGPWSVVGSGAHVVDSILFDRARIDEGAHVKRAILDKEVVVEAGAEIGVDRAADLARGFIVTDSGLTVVGKGSRVRARA
Sample Types
Isolate
36.8%
Metagenome
63.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.4%
Termitidae
17.4%
Formicidae
14.0%
Kalotermitidae
7.4%
Culicidae
7.4%
Scarabaeidae
5.0%
Cambaridae
4.1%
Elmidae
3.3%
Tenebrionidae
3.3%
Armadillidiidae
3.3%
Hydrophilidae
1.7%
Cerambycidae
1.7%
Cimicidae
0.8%
Ixodidae
0.8%
Rhinotermitidae
0.8%
Reduviidae
0.8%
Pentatomidae
0.8%
Pyralidae
0.8%
Taxonomy
Archaea
0
Bacteria
199
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 2 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 3 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 4 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 5 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 6 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 7 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 8 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 9 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 10 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 13 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 14 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 15 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 19 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 20 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 21 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 22 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 23 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 24 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 25 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 26 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 27 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 28 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 29 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 30 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 31 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 32 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 33 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 34 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 35 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 36 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 42 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 43 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 44 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 45 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 46 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 47 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 48 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 49 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 50 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 51 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 52 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 53 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 54 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 55 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 56 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 57 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 58 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 59 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 60 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 61 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 62 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 63 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 64 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 65 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 66 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 67 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 68 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 69 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 70 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 71 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 72 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 73 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 74 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 75 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 76 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 77 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 78 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 79 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 80 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 81 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 82 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 83 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 84 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 85 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 86 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 87 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 88 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 89 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 90 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 91 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 92 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 93 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 94 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 95 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 96 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 97 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 98 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 99 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 100 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 101 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 102 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 103 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 104 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 105 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 106 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 107 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 108 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 109 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 110 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 111 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 112 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 113 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 114 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 115 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 116 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 117 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 118 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 119 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 120 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 121 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 122 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 123 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 124 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 125 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 126 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 127 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 128 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 129 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 130 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466723_310480 | 3300042618 | Bacteria | 13696 |
| 2 | Ga0466728_320010 | 3300042620 | Unclassified | 4642 |
| 3 | Ga0466707_334115 | 3300042601 | Bacteria | 1705 |
| 4 | Ga0466713_082605 | 3300042602 | Bacteria | 26852 |
| 5 | Ga0466713_085340 | 3300042602 | Bacteria | 38840 |
| 6 | Ga0466716_463791 | 3300042605 | Bacteria | 3021 |
| 7 | Ga0123357_10006944 | 3300009784 | Bacteria | 13913 |
| 8 | Ga0123356_10298366 | 3300010049 | Bacteria | 1715 |
| 9 | Ga0160464_100793 | 3300012805 | Bacteria | 17360 |
| 10 | Ga0466730_030378 | 3300042625 | Bacteria | 3035 |
| 11 | Ga0466704_191668 | 3300042643 | Bacteria | 22529 |
| 12 | Ga0466724_05941 | 3300042649 | Bacteria | 68311 |
| 13 | Ga0160432_100118 | 3300012818 | Bacteria | 76275 |
| 14 | Ga0160432_100891 | 3300012818 | Bacteria | 12930 |
| 15 | Ga0562374_0020 | 3300057007 | Bacteria | 1125244 |
| 16 | Ga0466728_449811 | 3300042620 | Bacteria | 7374 |
| 17 | Ga0466707_029760 | 3300042601 | Bacteria | 5402 |
| 18 | Ga0466707_121644 | 3300042601 | Bacteria | 13873 |
| 19 | Ga0466713_064780 | 3300042602 | Bacteria | 3975 |
| 20 | Ga0466719_407591 | 3300042606 | Bacteria | 5001 |
| 21 | Ga0123356_10000137 | 3300010049 | Bacteria | 82109 |
| 22 | Ga0123356_10244819 | 3300010049 | Bacteria | 1867 |
| 23 | Ga0123356_10329075 | 3300010049 | Bacteria | 1644 |
| 24 | Ga0160454_102284 | 3300012798 | Unclassified | 2210 |
| 25 | Ga0466730_002766 | 3300042625 | Bacteria | 44764 |
| 26 | Ga0466730_004385 | 3300042625 | Bacteria | 1420 |
| 27 | Ga0466730_038154 | 3300042625 | Bacteria | 7607 |
| 28 | Ga0466703_351953 | 3300042636 | Bacteria | 5003 |
| 29 | Ga0466724_46140 | 3300042649 | Bacteria | 630192 |
| 30 | Ga0160469_103183 | 3300012824 | Bacteria | 2428 |
| 31 | Ga0466707_397359 | 3300042601 | Bacteria | 3584 |
| 32 | Ga0123357_10126592 | 3300009784 | Bacteria | 3198 |
| 33 | Ga0123356_10000060 | 3300010049 | Bacteria | 114492 |
| 34 | Ga0123356_10001703 | 3300010049 | Bacteria | 24069 |
| 35 | Ga0123356_10016516 | 3300010049 | Bacteria | 7039 |
| 36 | Ga0123353_10096478 | 3300010167 | Bacteria | 4765 |
| 37 | Ga0466704_444563 | 3300042643 | Bacteria | 3339 |
| 38 | AglaG_contig09508 | 2084038013 | Bacteria | 1592 |
| 39 | AustNasuHG_c1000299 | 3300000089 | Bacteria | 17184 |
| 40 | Ga0072940_1137886 | 3300005200 | Bacteria | 3936 |
| 41 | Ga0123357_10000007 | 3300009784 | Bacteria | 257289 |
| 42 | Ga0160446_100077 | 3300012835 | Bacteria | 97363 |
| 43 | Ga0160447_104114 | 3300012849 | Bacteria | 4398 |
| 44 | Ga0160448_100428 | 3300012854 | Bacteria | 14808 |
| 45 | Ga0466693_354246 | 3300042592 | Bacteria | 62518 |
| 46 | Ga0466733_059557 | 3300042659 | Bacteria | 11427 |
| 47 | Ga0466733_084639 | 3300042659 | Bacteria | 25822 |
| 48 | Ga0466710_414203 | 3300042613 | Bacteria | 3094 |
| 49 | Ga0466713_032693 | 3300042602 | Bacteria | 139937 |
| 50 | Ga0466713_088144 | 3300042602 | Bacteria | 17171 |
| 51 | Ga0466713_135216 | 3300042602 | Bacteria | 5097 |
| 52 | Ga0466719_126830 | 3300042606 | Bacteria | 53853 |
| 53 | Ga0123357_10065431 | 3300009784 | Bacteria | 4854 |
| 54 | Ga0123354_10060104 | 3300010882 | Bacteria | 5627 |
| 55 | Ga0466734_004146 | 3300042623 | Bacteria | 3662 |
| 56 | Ga0466730_081587 | 3300042625 | Bacteria | 1860 |
| 57 | Ga0466703_221626 | 3300042636 | Bacteria | 46159 |
| 58 | JGI24699J35502_11133593 | 3300002509 | Bacteria | 12325 |
| 59 | Ga0160432_101848 | 3300012818 | Bacteria | 5662 |
| 60 | Ga0160431_102543 | 3300012828 | Unclassified | 4211 |
| 61 | Ga0160458_105825 | 3300012832 | Bacteria | 1454 |
| 62 | Ga0160434_105997 | 3300012850 | Unclassified | 2008 |
| 63 | Ga0160430_100407 | 3300012852 | Bacteria | 25654 |
| 64 | Ga0466693_109461 | 3300042592 | Bacteria | 182600 |
| 65 | Ga0562379_0096 | 3300056790 | Bacteria | 309415 |
| 66 | Ga0466723_168295 | 3300042618 | Bacteria | 9453 |
| 67 | Ga0466707_192239 | 3300042601 | Bacteria | 58455 |
| 68 | Ga0466713_067791 | 3300042602 | Bacteria | 94888 |
| 69 | Ga0466713_110734 | 3300042602 | Bacteria | 5308 |
| 70 | Ga0123357_10173890 | 3300009784 | Bacteria | 2538 |
| 71 | Ga0123357_10271765 | 3300009784 | Bacteria | 1770 |
| 72 | Ga0123357_10336605 | 3300009784 | Bacteria | 1466 |
| 73 | Ga0123354_10007820 | 3300010882 | Bacteria | 16186 |
| 74 | Ga0160464_100575 | 3300012805 | Bacteria | 24463 |
| 75 | Ga0466734_125783 | 3300042623 | Bacteria | 1475 |
| 76 | Ga0466704_329352 | 3300042643 | Bacteria | 4013 |
| 77 | Ga0466704_384808 | 3300042643 | Bacteria | 5341 |
| 78 | AustNasuHG_c1008515 | 3300000089 | Bacteria | 3630 |
| 79 | Ga0160459_100033 | 3300012831 | Bacteria | 259391 |
| 80 | Ga0160447_105732 | 3300012849 | Unclassified | 3400 |
| 81 | Ga0466733_063884 | 3300042659 | Bacteria | 94180 |
| 82 | Ga0466705_473868 | 3300042612 | Unclassified | 7185 |
| 83 | Ga0466718_047686 | 3300042617 | Bacteria | 3881 |
| 84 | Ga0466723_202928 | 3300042618 | Bacteria | 16495 |
| 85 | Ga0466700_385552 | 3300042600 | Bacteria | 18611 |
| 86 | Ga0466707_256599 | 3300042601 | Bacteria | 2047 |
| 87 | Ga0466707_410949 | 3300042601 | Bacteria | 6290 |
| 88 | Ga0123353_10083844 | 3300010167 | Bacteria | 5130 |
| 89 | Ga0123354_10000204 | 3300010882 | Bacteria | 51430 |
| 90 | Ga0466703_015457 | 3300042636 | Bacteria | 6433 |
| 91 | Ga0466703_185011 | 3300042636 | Bacteria | 25098 |
| 92 | Ga0466704_358733 | 3300042643 | Unclassified | 8145 |
| 93 | Ga0466725_405685 | 3300042654 | Bacteria | 1971 |
| 94 | JGI24705J35276_12211870 | 3300002504 | Bacteria | 1869 |
| 95 | JGI24705J35276_12233143 | 3300002504 | Bacteria | 4676 |
| 96 | Ga0123357_10000937 | 3300009784 | Bacteria | 29683 |
| 97 | Ga0160457_1003034 | 3300012858 | Unclassified | 3099 |
| 98 | Ga0466691_071421 | 3300042593 | Bacteria | 7315 |
| 99 | Ga0466696_225080 | 3300042596 | Bacteria | 14486 |
| 100 | Ga0466696_381585 | 3300042596 | Bacteria | 5392 |
| 101 | Ga0466705_001810 | 3300042612 | Bacteria | 1865 |
| 102 | Ga0562379_0256 | 3300056790 | Bacteria | 139436 |
| 103 | Ga0562376_1353 | 3300056857 | Bacteria | 35020 |
| 104 | Ga0466705_430981 | 3300042612 | Bacteria | 5677 |
| 105 | Ga0466728_321186 | 3300042620 | Bacteria | 2362 |
| 106 | Ga0466713_004199 | 3300042602 | Bacteria | 8039 |
| 107 | Ga0466716_175407 | 3300042605 | Bacteria | 25596 |
| 108 | Ga0123356_10269477 | 3300010049 | Unclassified | 1792 |
| 109 | Ga0466725_447615 | 3300042654 | Bacteria | 6872 |
| 110 | AustNasuHG_c1024664 | 3300000089 | Bacteria | 1901 |
| 111 | Ga0160441_100872 | 3300012825 | Bacteria | 14780 |
| 112 | Ga0160455_100886 | 3300012837 | Bacteria | 11339 |
| 113 | Ga0160435_1012078 | 3300012857 | Unclassified | 1741 |
| 114 | Ga0160457_1001559 | 3300012858 | Bacteria | 6126 |
| 115 | Ga0466705_001161 | 3300042612 | Bacteria | 27928 |
| 116 | Ga0466718_000175 | 3300042617 | Bacteria | 10256 |
| 117 | Ga0466729_062079 | 3300042621 | Bacteria | 18297 |
| 118 | Ga0466707_159556 | 3300042601 | Bacteria | 111445 |
| 119 | Ga0123354_10129475 | 3300010882 | Bacteria | 3197 |
| 120 | Ga0123354_10132078 | 3300010882 | Bacteria | 3147 |
| 121 | Ga0466703_383518 | 3300042636 | Bacteria | 43660 |
| 122 | Ga0072940_1099196 | 3300005200 | Bacteria | 6000 |
| 123 | Ga0123357_10000122 | 3300009784 | Bacteria | 66741 |
| 124 | Ga0160456_102255 | 3300012820 | Bacteria | 3697 |
| 125 | Ga0160469_100216 | 3300012824 | Bacteria | 49012 |
| 126 | Ga0160452_100059 | 3300012834 | Bacteria | 146119 |
| 127 | Ga0160446_100225 | 3300012835 | Bacteria | 38731 |
| 128 | Ga0160447_108970 | 3300012849 | Bacteria | 2334 |
| 129 | Ga0160430_101227 | 3300012852 | Bacteria | 10058 |
| 130 | Ga0160435_1003268 | 3300012857 | Bacteria | 3852 |
| 131 | Ga0160436_1000500 | 3300012861 | Bacteria | 14763 |
| 132 | Ga0466657_325722 | 3300042582 | Bacteria | 7078 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00483 | GO:0009058 | biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.