Protein Family IF13216

Metagenome Isolate
128 Members
41 Samples
115 Scaffolds
306.49 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2989309576|2989311045|
Length
318 aa
Sequence
MSEAVALDKQAELKTDSKLEKLYSLGHFVVTGELGPPQHAEGHELEHHAHELKDIVDGFNLTDNQTAIVRLSSIAAGIHVLKGGGVPIIQMTCRDRNRIAMQSDLLGAYSLGIRDVLCLSGDHQSFGNHPTSKNVYDVDSVQLIAMVKKMRDDKKFLSDAVIKANEPRFFIGAVENPFGDPFEFRAIRLEKKVNAGADFIQTQAIFDLEKFARFMEMAVARGIHERTKITAGILPVRSVKALQYMKKDVAGMEIPDSLIERMKKAEDPKKEGIQVAIEMCNELKKIPGVAGIHIMPVGWEAALPEIVKGAGFLPRPKV

📊 Sample Types

Isolate 10.2%
Metagenome 89.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.3%
Unclassified 31.7%
Kalotermitidae 22.0%

🌳 Taxonomy

Archaea 5
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
2 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
3 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
4 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
7 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
8 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
9 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
13 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
14 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
18 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
19 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
25 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
26 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
27 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
28 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
31 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
36 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
37 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
38 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
39 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
40 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_227439 3300042616 Unclassified 15599
2 Ga0466723_031893 3300042618 Bacteria 28200
3 Ga0123356_10000074 3300010049 Bacteria 105474
4 Ga0123356_10001232 3300010049 Bacteria 28423
5 Ga0123356_10007236 3300010049 Bacteria 11093
6 Ga0123356_10105011 3300010049 Bacteria 2717
7 Ga0123356_10125455 3300010049 Bacteria 2505
8 Ga0123356_10227641 3300010049 Bacteria 1926
9 Ga0123356_10429665 3300010049 Bacteria 1465
10 Ga0123353_10096461 3300010167 Bacteria 4765
11 Ga0123353_10111534 3300010167 Bacteria 4405
12 Ga0123353_10285386 3300010167 Bacteria 2532
13 Ga0123354_10256594 3300010882 Archaea 1757
14 Ga0466709_220148 3300042648 Bacteria 3767
15 Ga0466691_210285 3300042593 Bacteria 16870
16 Ga0466723_002044 3300042618 Bacteria 23230
17 Ga0123356_10008217 3300010049 Bacteria 10386
18 Ga0123356_10028225 3300010049 Bacteria 5257
19 Ga0123356_10041116 3300010049 Bacteria 4308
20 Ga0123356_10070670 3300010049 Bacteria 3275
21 Ga0123356_10282228 3300010049 Bacteria 1757
22 Ga0123356_10357814 3300010049 Bacteria 1586
23 Ga0123353_10013973 3300010167 Archaea 11547
24 Ga0123353_10396641 3300010167 Bacteria 2056
25 Ga0123353_10579088 3300010167 Bacteria 1611
26 JGI24702J35022_10000730 3300002462 Bacteria 20220
27 JGI24705J35276_12238256 3300002504 Bacteria 18004
28 Ga0466714_106794 3300042603 Bacteria 4930
29 Ga0466697_079902 3300042611 Bacteria 2935
30 Ga0466696_050672 3300042596 Bacteria 3225
31 Ga0466710_378972 3300042613 Bacteria 2011
32 Ga0466715_329047 3300042616 Bacteria 18764
33 Ga0466718_159379 3300042617 Archaea 3174
34 Ga0123355_10125968 3300009826 Bacteria 3958
35 Ga0123355_10213243 3300009826 Bacteria 2793
36 Ga0123356_10069156 3300010049 Bacteria 3311
37 Ga0123356_10127038 3300010049 Bacteria 2491
38 Ga0123356_10139176 3300010049 Bacteria 2392
39 Ga0123356_10215559 3300010049 Unclassified 1972
40 Ga0123356_10233461 3300010049 Bacteria 1905
41 Ga0123356_10302202 3300010049 Bacteria 1706
42 Ga0123356_10692031 3300010049 Bacteria 1188
43 Ga0123353_10009546 3300010167 Bacteria 13413
44 Ga0123353_10066640 3300010167 Bacteria 5780
45 Ga0123353_10075084 3300010167 Bacteria 5433
46 Ga0123353_10249849 3300010167 Bacteria 2748
47 Ga0123353_10475973 3300010167 Bacteria 1829
48 Ga0123353_10582805 3300010167 Bacteria 1604
49 Ga0466721_212058 3300042608 Bacteria 1286
50 Ga0466728_117802 3300042620 Bacteria 1193
51 Ga0123356_10004767 3300010049 Bacteria 13953
52 Ga0123356_10126728 3300010049 Bacteria 2494
53 Ga0123356_10521920 3300010049 Bacteria 1346
54 Ga0123356_10681811 3300010049 Bacteria 1196
55 Ga0123353_10212307 3300010167 Bacteria 3035
56 JGI24702J35022_10000007 3300002462 Bacteria 87099
57 Ga0466707_229444 3300042601 Bacteria 4298
58 Ga0466707_414502 3300042601 Bacteria 1140
59 Ga0466717_060108 3300042604 Bacteria 1484
60 Ga0466698_019968 3300042610 Bacteria 1495
61 Ga0466705_220140 3300042612 Bacteria 12275
62 Ga0466710_121896 3300042613 Bacteria 1352
63 Ga0466715_639179 3300042616 Bacteria 2801
64 Ga0466728_175978 3300042620 Bacteria 4049
65 Ga0123356_10000501 3300010049 Bacteria 43707
66 Ga0123356_10001418 3300010049 Bacteria 26511
67 Ga0123356_10006073 3300010049 Bacteria 12250
68 Ga0123356_10006340 3300010049 Bacteria 11938
69 Ga0123356_10021634 3300010049 Unclassified 6069
70 Ga0123356_10255508 3300010049 Bacteria 1833
71 Ga0123356_10443744 3300010049 Bacteria 1444
72 Ga0123356_10815416 3300010049 Bacteria 1104
73 Ga0123353_10000566 3300010167 Bacteria 45539
74 JGI24700J35501_10930814 3300002508 Bacteria 25410
75 Ga0466715_287355 3300042616 Bacteria 29422
76 Ga0123356_10039490 3300010049 Bacteria 4397
77 Ga0123353_10559427 3300010167 Bacteria 1647
78 Ga0123353_10607280 3300010167 Bacteria 1561
79 Ga0466725_087743 3300042654 Bacteria 1299
80 Ga0466725_448736 3300042654 Bacteria 4635
81 Ga0466716_247168 3300042605 Bacteria 1977
82 Ga0466691_045081 3300042593 Bacteria 1841
83 Ga0123357_10091692 3300009784 Bacteria 3956
84 Ga0123355_10000479 3300009826 Bacteria 53101
85 Ga0123356_10026426 3300010049 Unclassified 5448
86 Ga0123356_10036962 3300010049 Bacteria 4558
87 Ga0123356_10178092 3300010049 Bacteria 2145
88 Ga0123356_10226483 3300010049 Bacteria 1930
89 Ga0123353_10130450 3300010167 Bacteria 4034
90 Ga0123353_10173747 3300010167 Bacteria 3418
91 Ga0123353_10268770 3300010167 Bacteria 2629
92 Ga0123353_10578096 3300010167 Bacteria 1613
93 Ga0123354_10000413 3300010882 Bacteria 41600
94 Ga0123354_10101479 3300010882 Bacteria 3885
95 Ga0466734_069045 3300042623 Bacteria 1968
96 Ga0466702_201458 3300042635 Bacteria 11755
97 Ga0466708_174426 3300042652 Bacteria 3466
98 Ga0466708_186399 3300042652 Bacteria 63543
99 Ga0466708_308164 3300042652 Bacteria 16289
100 Ga0466700_149111 3300042600 Bacteria 2260
101 Ga0466707_366956 3300042601 Unclassified 1523
102 Ga0466716_020222 3300042605 Bacteria 4533
103 Ga0466721_297058 3300042608 Bacteria 10682
104 Ga0466728_192023 3300042620 Archaea 1025
105 Ga0123356_10040823 3300010049 Archaea 4322
106 Ga0123356_10119489 3300010049 Bacteria 2560
107 Ga0123356_10246413 3300010049 Bacteria 1861
108 Ga0123356_10341668 3300010049 Bacteria 1617
109 Ga0123356_10609681 3300010049 Bacteria 1257
110 Ga0123356_10638205 3300010049 Bacteria 1232
111 Ga0123356_10951633 3300010049 Bacteria 1030
112 Ga0123354_10274643 3300010882 Bacteria 1651
113 Ga0466702_258580 3300042635 Bacteria 1330
114 Ga0466709_216715 3300042648 Bacteria 2028
115 Ga0466707_411788 3300042601 Bacteria 1276

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_366956 Ga0466707_366956_612_1460 269
2 3300010049 Ga0123356_10443744 Ga0123356_104437441 270
3 3300009826 Ga0123355_10213243 Ga0123355_102132434 280
4 3300010049 Ga0123356_10246413 Ga0123356_102464132 280
5 3300010167 Ga0123353_10475973 Ga0123353_104759733 280
6 3300010167 Ga0123353_10579088 Ga0123353_105790882 282
7 3300042601 Ga0466707_414502 Ga0466707_414502_19_867 282
8 3300010049 Ga0123356_10001418 Ga0123356_100014182 284
9 3300042601 Ga0466707_411788 Ga0466707_411788_212_1138 289
10 3300042608 Ga0466721_212058 Ga0466721_212058_367_1239 290
11 3300042600 Ga0466700_149111 Ga0466700_149111_1178_2095 293
12 3300042616 Ga0466715_227439 Ga0466715_227439_7357_8256 299
13 3300042635 Ga0466702_201458 Ga0466702_201458_5187_6104 300
14 3300042620 Ga0466728_192023 Ga0466728_192023_31_936 301
15 3300042605 Ga0466716_020222 Ga0466716_020222_1304_2215 303
16 3300010049 Ga0123356_10036962 Ga0123356_100369623 305
17 3300010049 Ga0123356_10041116 Ga0123356_100411163 305
18 3300010049 Ga0123356_10227641 Ga0123356_102276412 305
19 3300042608 Ga0466721_297058 Ga0466721_297058_6516_7433 305
20 3300042611 Ga0466697_079902 Ga0466697_079902_1223_2140 305
21 3300042613 Ga0466710_378972 Ga0466710_378972_41_958 305
22 3300042623 Ga0466734_069045 Ga0466734_069045_96_1013 305
23 3300042654 Ga0466725_087743 Ga0466725_087743_273_1190 305
24 iso_pr_bacteria 2819994798 2819997554 305
25 iso_pr_bacteria 2820412446 2820412463 305
26 iso_pr_bacteria 2820442516 2820443826 305
27 iso_pr_bacteria 2820483401 2820484325 305
28 iso_pr_bacteria 2820566695 2820567914 305
29 3300002508 JGI24700J35501_10930814 JGI24700J35501_1093081410 306
30 3300009826 Ga0123355_10000479 Ga0123355_100004798 306
31 3300009826 Ga0123355_10125968 Ga0123355_101259682 306
32 3300010049 Ga0123356_10000501 Ga0123356_100005012 306
33 3300010049 Ga0123356_10004767 Ga0123356_100047679 306
34 3300010049 Ga0123356_10006073 Ga0123356_100060733 306
35 3300010049 Ga0123356_10007236 Ga0123356_100072366 306
36 3300010049 Ga0123356_10008217 Ga0123356_1000821710 306
37 3300010049 Ga0123356_10028225 Ga0123356_100282253 306
38 3300010049 Ga0123356_10039490 Ga0123356_100394903 306
39 3300010049 Ga0123356_10070670 Ga0123356_100706703 306
40 3300010049 Ga0123356_10215559 Ga0123356_102155593 306
41 3300010049 Ga0123356_10226483 Ga0123356_102264832 306
42 3300010049 Ga0123356_10233461 Ga0123356_102334612 306
43 3300010049 Ga0123356_10282228 Ga0123356_102822282 306
44 3300010049 Ga0123356_10302202 Ga0123356_103022022 306
45 3300010049 Ga0123356_10341668 Ga0123356_103416682 306
46 3300010049 Ga0123356_10429665 Ga0123356_104296652 306
47 3300010049 Ga0123356_10692031 Ga0123356_106920312 306
48 3300010049 Ga0123356_10815416 Ga0123356_108154161 306
49 3300010167 Ga0123353_10000566 Ga0123353_1000056627 306
50 3300010167 Ga0123353_10075084 Ga0123353_100750845 306
51 3300010167 Ga0123353_10096461 Ga0123353_100964613 306
52 3300010167 Ga0123353_10173747 Ga0123353_101737473 306
53 3300010167 Ga0123353_10212307 Ga0123353_102123072 306
54 3300010167 Ga0123353_10249849 Ga0123353_102498493 306
55 3300010167 Ga0123353_10396641 Ga0123353_103966413 306
56 3300010167 Ga0123353_10559427 Ga0123353_105594271 306
57 3300010167 Ga0123353_10578096 Ga0123353_105780962 306
58 3300010167 Ga0123353_10582805 Ga0123353_105828053 306
59 3300010882 Ga0123354_10000413 Ga0123354_1000041317 306
60 3300010882 Ga0123354_10101479 Ga0123354_101014793 306
61 3300010882 Ga0123354_10256594 Ga0123354_102565942 306
62 3300010882 Ga0123354_10274643 Ga0123354_102746432 306
63 3300042617 Ga0466718_159379 Ga0466718_159379_602_1522 306
64 3300010049 Ga0123356_10000074 Ga0123356_1000007440 307
65 3300010049 Ga0123356_10040823 Ga0123356_100408234 307
66 3300010049 Ga0123356_10127038 Ga0123356_101270383 307
67 3300010049 Ga0123356_10139176 Ga0123356_101391762 307
68 3300010049 Ga0123356_10521920 Ga0123356_105219201 307
69 3300010049 Ga0123356_10638205 Ga0123356_106382052 307
70 3300010167 Ga0123353_10009546 Ga0123353_100095466 307
71 3300010167 Ga0123353_10111534 Ga0123353_101115343 307
72 3300042618 Ga0466723_002044 Ga0466723_002044_3577_4500 307
73 3300010049 Ga0123356_10001232 Ga0123356_1000123222 308
74 3300010167 Ga0123353_10607280 Ga0123353_106072802 308
75 3300042604 Ga0466717_060108 Ga0466717_060108_85_1011 308
76 3300042610 Ga0466698_019968 Ga0466698_019968_337_1263 308
77 iso_pr_bacteria 2820314258 2820316503 308
78 iso_pr_bacteria 2820324456 2820324707 308
79 iso_pr_bacteria 2820324456 2820326909 308
80 3300002504 JGI24705J35276_12238256 JGI24705J35276_122382567 309
81 3300009784 Ga0123357_10091692 Ga0123357_100916923 309
82 3300010049 Ga0123356_10357814 Ga0123356_103578142 309
83 3300010167 Ga0123353_10013973 Ga0123353_100139734 309
84 3300010167 Ga0123353_10066640 Ga0123353_100666403 309
85 3300010167 Ga0123353_10268770 Ga0123353_102687703 309
86 3300010167 Ga0123353_10285386 Ga0123353_102853862 309
87 3300010049 Ga0123356_10006340 Ga0123356_1000634013 310
88 3300010049 Ga0123356_10021634 Ga0123356_100216343 310
89 3300010049 Ga0123356_10026426 Ga0123356_100264265 310
90 3300010049 Ga0123356_10119489 Ga0123356_101194892 310
91 3300042603 Ga0466714_106794 Ga0466714_106794_57_989 310
92 iso_pr_bacteria 2820227065 2820227106 310
93 iso_pr_bacteria 2820238527 2820238906 310
94 3300002462 JGI24702J35022_10000730 JGI24702J35022_1000073010 311
95 3300042613 Ga0466710_121896 Ga0466710_121896_278_1213 311
96 3300042616 Ga0466715_329047 Ga0466715_329047_12784_13719 311
97 3300042620 Ga0466728_117802 Ga0466728_117802_88_1023 311
98 3300042652 Ga0466708_308164 Ga0466708_308164_8417_9352 311
99 3300010049 Ga0123356_10126728 Ga0123356_101267282 312
100 3300010049 Ga0123356_10255508 Ga0123356_102555081 312
101 3300010049 Ga0123356_10951633 Ga0123356_109516331 312
102 3300042593 Ga0466691_045081 Ga0466691_045081_485_1423 312
103 3300042593 Ga0466691_210285 Ga0466691_210285_6583_7521 312
104 3300042616 Ga0466715_639179 Ga0466715_639179_379_1317 312
105 3300042620 Ga0466728_175978 Ga0466728_175978_3022_3960 312
106 3300042648 Ga0466709_220148 Ga0466709_220148_586_1524 312
107 3300042652 Ga0466708_174426 Ga0466708_174426_111_1049 312
108 iso_pr_bacteria 2820357977 2820359031 312
109 3300010049 Ga0123356_10069156 Ga0123356_100691563 313
110 3300010167 Ga0123353_10130450 Ga0123353_101304503 313
111 3300042601 Ga0466707_229444 Ga0466707_229444_2051_2992 313
112 iso_pr_bacteria 2820223845 2820223877 313
113 3300002462 JGI24702J35022_10000007 JGI24702J35022_1000000732 314
114 3300042605 Ga0466716_247168 Ga0466716_247168_835_1779 314
115 3300042648 Ga0466709_216715 Ga0466709_216715_906_1850 314
116 3300010049 Ga0123356_10125455 Ga0123356_101254553 315
117 3300042596 Ga0466696_050672 Ga0466696_050672_1837_2784 315
118 3300042616 Ga0466715_287355 Ga0466715_287355_8676_9623 315
119 3300042618 Ga0466723_031893 Ga0466723_031893_22562_23509 315
120 3300042652 Ga0466708_186399 Ga0466708_186399_42703_43650 315
121 3300042654 Ga0466725_448736 Ga0466725_448736_3103_4050 315
122 3300010049 Ga0123356_10178092 Ga0123356_101780923 316
123 3300042635 Ga0466702_258580 Ga0466702_258580_119_1072 317
124 3300010049 Ga0123356_10105011 Ga0123356_101050113 318
125 iso_pr_bacteria 2989309576 2989311045 318
126 3300010049 Ga0123356_10681811 Ga0123356_106818111 319
127 3300042612 Ga0466705_220140 Ga0466705_220140_7866_8837 323
128 3300010049 Ga0123356_10609681 Ga0123356_106096812 332

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02219 MTHFR Methylenetetrahydrofolate reductase 19 310 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.