Protein Family IF13092

Metagenome Isolate
222 Members
147 Samples
119 Scaffolds
381.37 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2940400224|2940404965|
Length
409 aa
Sequence
LRAVHFGAGNIGRGFIGPMLSNSGYRVCFVGRNTNKITQLQGRGQYSITFANENRDSYIVDNVTAVNLGDTAEVAKEIAKAEIVTTAVGITALKDIASTLARGIELRLSNGEQSKPLHVFACENGMKSSQQLKEAVYRHLKHSCKELADRFVAFPNVMVDRIVPVQKNKDPLEILVEPFSEWVIPRSDMIGDYNEIKGAHYVDSLDPYLERKLFTVNTGHCSAAYFGYMEGYHSIQEAMSDPGIRSRVQGVLRETGSLLIHQYGFDPEVHEKYIQKMMGRFSNPNFTDTVNRVARSPLRKLSPSERLVKPAMLANELGLETTYLVLAISNALFFDDNKDQEAVVLQEAIRNQGVSEVIRTKLGIPLEHPLHFQIVRGYNKLCLQYPHMSSSGFQSMFLRIRESAPKKFS

📊 Sample Types

Isolate 46.4%
Metagenome 53.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 18.7%
Drosophilidae 16.4%
Kalotermitidae 9.7%
Termitidae 8.2%
Scarabaeidae 6.7%
Blattidae 6.7%
Tenebrionidae 6.0%
Apidae 5.2%
Elmidae 3.0%
Armadillidiidae 3.0%
Rhinotermitidae 2.2%
Culicidae 2.2%
Termopsidae 2.2%
Curculionidae 1.5%
Formicidae 1.5%
Calliphoridae 0.7%
Bombycidae 0.7%
Gomphidae 0.7%
Nephropidae 0.7%
Libellulidae 0.7%
Passalidae 0.7%
Penaeidae 0.7%
Noctuidae 0.7%
Euphausiidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 201
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
2 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
3 2864909992 Bacillus velezensis S00166 Isolate Elmidae
4 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
5 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
6 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
7 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
8 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
9 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
14 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
15 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
16 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
21 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
22 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
23 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
24 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
25 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
26 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
27 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
28 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
29 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
30 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
31 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
32 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
33 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
34 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
35 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
36 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
37 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
38 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
39 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
40 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
41 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
42 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
45 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
46 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
47 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
48 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
49 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
50 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
51 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
52 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
53 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
54 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
55 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
58 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
59 8007223943 Enterococcus sp. MSG2901 Isolate
60 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
61 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
62 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
63 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
64 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
65 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
66 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
67 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
68 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
69 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
70 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
71 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
72 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
73 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
74 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
75 2864895409 Bacillus aerius S00152 Isolate Elmidae
76 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
77 2916858470 Heyndrickxia oleronia Isolate Unclassified
78 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
79 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
80 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
81 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
82 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
83 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
84 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
85 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
86 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
87 8114555646 Enterococcus sp. DIV1094 Isolate
88 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
89 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
90 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
91 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
92 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
93 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
94 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
95 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
96 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
97 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
98 8064008355 Heyndrickxia oleronia Isolate Unclassified
99 8082023105 Niallia sp. Man26 Isolate Penaeidae
100 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
101 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
102 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
103 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
104 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
105 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
106 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
107 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
108 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
109 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
110 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
111 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
112 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
113 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
114 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
115 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
116 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
117 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
118 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
119 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
120 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
121 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
122 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
123 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
124 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
125 8103002986 Erwinia sp. S38 Isolate Curculionidae
126 8108568626 Enterococcus sp. DIV1094 Isolate
127 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
128 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
129 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
130 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
131 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
132 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
133 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
134 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
135 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
136 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
137 2864801025 Bacillus aerius S00042 Isolate Elmidae
138 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
139 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
140 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
141 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
142 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
143 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
144 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
145 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
146 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
147 8077780672 Enterococcus sp. PLM3 Isolate Formicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_188876 3300042659 Bacteria 10934
2 Ga0562379_0171 3300056790 Bacteria 192504
3 Ga0562379_3403 3300056790 Unclassified 10541
4 Ga0562379_3812 3300056790 Bacteria 9021
5 Ga0562377_0114 3300056842 Unclassified 258244
6 Ga0466731_409311 3300042622 Bacteria 8920
7 Ga0466703_103652 3300042636 Bacteria 1666
8 Ga0466726_196423 3300042619 Bacteria 10516
9 Ga0160456_103803 3300012820 Bacteria 2164
10 Ga0160435_1010944 3300012857 Unclassified 1865
11 Ga0466696_020457 3300042596 Bacteria 3395
12 Ga0466696_176667 3300042596 Bacteria 2375
13 Ga0466705_101400 3300042612 Unclassified 1906
14 Ga0530661_000396 3300056564 Bacteria 32681
15 Ga0562377_0117 3300056842 Unclassified 248603
16 Ga0562377_0245 3300056842 Bacteria 125870
17 Ga0466734_063529 3300042623 Bacteria 2316
18 Ga0466730_068269 3300042625 Unclassified 4100
19 Ga0466711_121655 3300042615 Unclassified 4615
20 Ga0466700_205252 3300042600 Bacteria 5858
21 Ga0160455_102507 3300012837 Bacteria 3730
22 Ga0466690_059040 3300042590 Bacteria 3648
23 Ga0466691_039775 3300042593 Bacteria 18301
24 Ga0466696_265296 3300042596 Bacteria 2352
25 Ga0466733_125516 3300042659 Bacteria 41402
26 Ga0562378_0032 3300056814 Bacteria 502759
27 Ga0562377_0078 3300056842 Bacteria 380003
28 Ga0562377_1255 3300056842 Unclassified 28362
29 Ga0562376_0219 3300056857 Bacteria 115439
30 Ga0562374_0014 3300057007 Bacteria 1241908
31 Ga0562374_0018 3300057007 Bacteria 1182001
32 Ga0466730_050878 3300042625 Bacteria 31540
33 Ga0466727_257150 3300042655 Bacteria 2536
34 Ga0466711_153149 3300042615 Bacteria 4567
35 Ga0466716_101571 3300042605 Bacteria 5353
36 Ga0456237_0005595 3300041968 Unclassified 1988
37 Ga0466690_100897 3300042590 Bacteria 7404
38 Ga0466696_191314 3300042596 Bacteria 1416
39 Ga0530661_004057 3300056564 Bacteria 4586
40 Ga0562377_0036 3300056842 Bacteria 678424
41 Ga0562374_2251 3300057007 Bacteria 17822
42 Ga0466735_044551 3300042624 Bacteria 5318
43 Ga0466704_174434 3300042643 Bacteria 2455
44 Ga0466704_604067 3300042643 Bacteria 2777
45 Ga0466723_091406 3300042618 Bacteria 3161
46 Ga0466723_176770 3300042618 Bacteria 5741
47 Ga0466700_123601 3300042600 Bacteria 6890
48 Ga0466713_093323 3300042602 Unclassified 34741
49 2211830569 2209111004 Bacteria 13650
50 JGI24703J35330_11652747 3300002501 Bacteria 1608
51 Ga0466691_069497 3300042593 Bacteria 12623
52 Ga0562375_0014 3300056856 Bacteria 1185783
53 Ga0562375_0048 3300056856 Bacteria 473654
54 Ga0466702_115861 3300042635 Bacteria 32387
55 Ga0466703_173650 3300042636 Bacteria 11061
56 Ga0466704_305982 3300042643 Bacteria 11763
57 Ga0466709_086341 3300042648 Bacteria 317133
58 Ga0466727_015733 3300042655 Bacteria 7079
59 Ga0160464_100450 3300012805 Bacteria 30731
60 Ga0466726_096186 3300042619 Bacteria 1557
61 Ga0466726_210991 3300042619 Bacteria 1476
62 Ga0466728_317213 3300042620 Bacteria 15205
63 Ga0466719_108632 3300042606 Bacteria 6011
64 JGI24700J35501_10912853 3300002508 Unclassified 3714
65 Ga0160447_116190 3300012849 Bacteria 1349
66 Ga0466690_084901 3300042590 Bacteria 3129
67 Ga0466690_102806 3300042590 Bacteria 5570
68 Ga0466692_026770 3300042591 Unclassified 14133
69 Ga0466692_165243 3300042591 Bacteria 12927
70 Ga0466691_098987 3300042593 Bacteria 12660
71 Ga0466733_194812 3300042659 Bacteria 9077
72 Ga0562376_0005 3300056857 Bacteria 2173693
73 Ga0562374_0107 3300057007 Bacteria 221596
74 Ga0562374_0903 3300057007 Unclassified 41174
75 Ga0466704_185539 3300042643 Bacteria 10589
76 Ga0466704_319240 3300042643 Bacteria 6492
77 Ga0466704_493946 3300042643 Bacteria 4735
78 Ga0466726_346119 3300042619 Bacteria 3652
79 Ga0466716_116772 3300042605 Bacteria 5315
80 Ga0466716_309051 3300042605 Bacteria 4374
81 JGI24703J35330_11748070 3300002501 Bacteria 10392
82 Ga0068305_10003003 3300005083 Bacteria 8118
83 Ga0160457_1001769 3300012858 Bacteria 5387
84 Ga0466696_029384 3300042596 Bacteria 7706
85 Ga0530661_000139 3300056564 Bacteria 64402
86 Ga0562379_0005 3300056790 Bacteria 2649770
87 Ga0562379_1867 3300056790 Bacteria 20780
88 Ga0562377_0641 3300056842 Bacteria 52294
89 Ga0562375_0047 3300056856 Bacteria 487855
90 Ga0562374_0006 3300057007 Bacteria 2178283
91 Ga0562374_0185 3300057007 Bacteria 135768
92 Ga0562374_0861 3300057007 Unclassified 42570
93 Ga0466704_448360 3300042643 Bacteria 2421
94 Ga0466724_46451 3300042649 Bacteria 19110
95 Ga0466705_404958 3300042612 Unclassified 4633
96 Ga0466723_253564 3300042618 Bacteria 4785
97 Ga0466719_172481 3300042606 Bacteria 1865
98 Ga0466722_156221 3300042609 Bacteria 7381
99 2227294681 2225789004 Unclassified 6667
100 CVPL010L_1000026 3300002932 Unclassified 70666
101 CVPL010L_1000060 3300002932 Unclassified 124006
102 Ga0105553_1198926 3300007767 Bacteria 2490
103 Ga0160455_102118 3300012837 Bacteria 4536
104 Ga0160433_104867 3300012846 Bacteria 2096
105 Ga0160436_1000942 3300012861 Bacteria 8858
106 Ga0466690_169267 3300042590 Bacteria 1996
107 Ga0466705_296380 3300042612 Bacteria 8439
108 Ga0562379_0474 3300056790 Unclassified 82932
109 Ga0562379_1439 3300056790 Unclassified 27197
110 Ga0562379_2122 3300056790 Unclassified 17955
111 Ga0562377_0005 3300056842 Bacteria 3519381
112 Ga0562375_0025 3300056856 Bacteria 749171
113 Ga0466704_088464 3300042643 Bacteria 2610
114 Ga0466727_100661 3300042655 Bacteria 2349
115 Ga0466715_011806 3300042616 Bacteria 6398
116 Ga0466719_124282 3300042606 Bacteria 55942
117 Ga0068305_10470918 3300005083 Bacteria 3423
118 Ga0456237_0002057 3300041968 Bacteria 3246
119 Ga0466690_351443 3300042590 Bacteria 2129

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01232 Mannitol_dh Mannitol dehydrogenase Rossmann domain 2 192 0.95
PF08125 Mannitol_dh_C Mannitol dehydrogenase C-terminal domain 205 346 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01232 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.