Protein Family IF12172
Metagenome
Isolate
246
Members
133
Samples
173
Scaffolds
167.14
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820816657|2820817908|
- Length
- 184 aa
- Sequence
- VTDVDPTDIIEEVEAAEEAVEVDEIPAAFVDEEDREIAYRSEETKTPEKSSRPAVVQNSRGTGRRKEAIARVRLAPGSGQWSINGRSLDDYFPNKLHQQEISEPFVTADVLGSYDVTALISGGGVSGQAGALRLGIARALNEADSEASRPGLKKAGMLTRDARIKERKKAGLKKARKAPQYSKR
Sample Types
Isolate
29.7%
Metagenome
70.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
39.3%
Termitidae
17.2%
Apidae
14.8%
Kalotermitidae
8.2%
Culicidae
4.9%
Scarabaeidae
2.5%
Termopsidae
2.5%
Tenebrionidae
2.5%
Rhinotermitidae
1.6%
Hydrophilidae
1.6%
Armadillidiidae
1.6%
Pyralidae
0.8%
Hodotermitidae
0.8%
Cerambycidae
0.8%
Cambaridae
0.8%
Taxonomy
Archaea
0
Bacteria
228
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 2 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 3 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 4 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 5 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 6 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 7 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 8 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 9 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 17 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 18 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 19 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 20 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 21 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 22 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 23 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 24 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 25 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 26 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 27 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 30 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 31 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 36 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 37 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 38 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 39 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 40 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 43 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 44 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 45 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 46 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 47 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 48 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 49 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 50 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 51 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 52 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 55 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 56 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 58 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 59 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 60 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 64 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 65 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 66 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 67 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 68 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 69 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 70 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 71 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 72 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 73 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 74 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 75 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 76 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 77 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 78 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 79 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 80 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 81 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 82 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 83 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 84 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 85 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 86 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 87 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 88 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 89 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 90 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 91 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 92 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 93 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 94 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 95 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 96 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 97 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 98 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 99 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 100 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 101 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 102 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 103 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 104 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 105 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 106 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 107 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 108 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 109 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 110 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 111 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 112 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 113 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 114 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 115 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 116 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 117 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 118 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 119 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 120 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 121 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 122 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 123 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 124 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 125 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 126 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 127 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 128 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 129 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 130 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 131 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 132 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 133 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_077916 | 3300042659 | Bacteria | 74008 |
| 2 | Ga0562378_3565 | 3300056814 | Bacteria | 8919 |
| 3 | Ga0562376_0016 | 3300056857 | Bacteria | 515529 |
| 4 | Ga0123357_10103136 | 3300009784 | Bacteria | 3670 |
| 5 | Ga0123357_10179894 | 3300009784 | Bacteria | 2473 |
| 6 | Ga0123356_10350471 | 3300010049 | Bacteria | 1600 |
| 7 | Ga0123354_10063124 | 3300010882 | Unclassified | 5446 |
| 8 | Ga0466713_036047 | 3300042602 | Bacteria | 4421 |
| 9 | Ga0466713_106963 | 3300042602 | Bacteria | 265396 |
| 10 | Ga0466719_497918 | 3300042606 | Bacteria | 1660 |
| 11 | Ga0466722_177849 | 3300042609 | Bacteria | 1229 |
| 12 | Ga0160441_105142 | 3300012825 | Unclassified | 1971 |
| 13 | Ga0466691_058824 | 3300042593 | Bacteria | 13322 |
| 14 | HBC_ctgsDRAFT_1002672 | 3300000333 | Unclassified | 4049 |
| 15 | JGI24705J35276_12206584 | 3300002504 | Bacteria | 1724 |
| 16 | Ga0123357_10000007 | 3300009784 | Bacteria | 257289 |
| 17 | Ga0123357_10000165 | 3300009784 | Bacteria | 60083 |
| 18 | Ga0466715_143706 | 3300042616 | Bacteria | 104427 |
| 19 | Ga0466729_083476 | 3300042621 | Bacteria | 1697 |
| 20 | Ga0123356_10573259 | 3300010049 | Bacteria | 1291 |
| 21 | Ga0123356_11567647 | 3300010049 | Bacteria | 814 |
| 22 | Ga0123354_10063925 | 3300010882 | Bacteria | 5402 |
| 23 | Ga0123354_10387162 | 3300010882 | Bacteria | 1200 |
| 24 | Ga0466706_156625 | 3300042599 | Bacteria | 1038 |
| 25 | Ga0466700_045890 | 3300042600 | Bacteria | 8382 |
| 26 | Ga0466713_102566 | 3300042602 | Bacteria | 10196 |
| 27 | Ga0466722_056273 | 3300042609 | Bacteria | 129656 |
| 28 | Ga0466722_113313 | 3300042609 | Bacteria | 2243 |
| 29 | Ga0466722_232149 | 3300042609 | Bacteria | 3864 |
| 30 | Ga0160448_100096 | 3300012854 | Unclassified | 46493 |
| 31 | JGI24699J35502_11127754 | 3300002509 | Bacteria | 4235 |
| 32 | Ga0072940_1030851 | 3300005200 | Bacteria | 5370 |
| 33 | Ga0466718_086770 | 3300042617 | Bacteria | 1917 |
| 34 | Ga0466718_117761 | 3300042617 | Bacteria | 3212 |
| 35 | Ga0466728_191051 | 3300042620 | Unclassified | 1571 |
| 36 | Ga0466728_407352 | 3300042620 | Bacteria | 4439 |
| 37 | Ga0466704_068889 | 3300042643 | Bacteria | 1821 |
| 38 | Ga0466708_048103 | 3300042652 | Bacteria | 5699 |
| 39 | Ga0562376_3376 | 3300056857 | Unclassified | 16226 |
| 40 | Ga0123356_10098835 | 3300010049 | Bacteria | 2796 |
| 41 | Ga0123356_10130808 | 3300010049 | Bacteria | 2459 |
| 42 | Ga0160466_100074 | 3300012809 | Bacteria | 108538 |
| 43 | Ga0466706_231257 | 3300042599 | Bacteria | 218825 |
| 44 | Ga0466713_024956 | 3300042602 | Bacteria | 12207 |
| 45 | Ga0466698_145270 | 3300042610 | Unclassified | 1395 |
| 46 | Ga0160432_105054 | 3300012818 | Bacteria | 1333 |
| 47 | Ga0160441_100613 | 3300012825 | Bacteria | 22453 |
| 48 | Ga0160431_106818 | 3300012828 | Unclassified | 1693 |
| 49 | Ga0466696_114729 | 3300042596 | Bacteria | 2505 |
| 50 | Ga0123357_10003435 | 3300009784 | Unclassified | 18142 |
| 51 | Ga0466705_451638 | 3300042612 | Bacteria | 2308 |
| 52 | Ga0466715_114767 | 3300042616 | Bacteria | 1553 |
| 53 | Ga0466729_127206 | 3300042621 | Bacteria | 2515 |
| 54 | Ga0466734_003604 | 3300042623 | Bacteria | 1124 |
| 55 | Ga0466703_112902 | 3300042636 | Bacteria | 3561 |
| 56 | Ga0466703_167791 | 3300042636 | Bacteria | 36422 |
| 57 | Ga0466704_571895 | 3300042643 | Bacteria | 129163 |
| 58 | Ga0466724_60137 | 3300042649 | Bacteria | 8896 |
| 59 | Ga0466727_029977 | 3300042655 | Bacteria | 1060 |
| 60 | Ga0466727_281927 | 3300042655 | Bacteria | 1230 |
| 61 | Ga0466727_342221 | 3300042655 | Bacteria | 1208 |
| 62 | Ga0466733_021508 | 3300042659 | Bacteria | 17604 |
| 63 | Ga0123357_10050496 | 3300009784 | Bacteria | 5630 |
| 64 | Ga0123356_10054071 | 3300010049 | Bacteria | 3739 |
| 65 | Ga0123354_10024100 | 3300010882 | Bacteria | 9602 |
| 66 | Ga0160448_111422 | 3300012854 | Bacteria | 1813 |
| 67 | Ga0160436_1001927 | 3300012861 | Bacteria | 5482 |
| 68 | Ga0466696_234179 | 3300042596 | Bacteria | 15414 |
| 69 | AglaG_contig18033 | 2084038013 | Bacteria | 5703 |
| 70 | Ga0068305_10400162 | 3300005083 | Bacteria | 1834 |
| 71 | Ga0123357_10000412 | 3300009784 | Bacteria | 40761 |
| 72 | Ga0466715_037111 | 3300042616 | Bacteria | 3574 |
| 73 | Ga0466723_246759 | 3300042618 | Bacteria | 5005 |
| 74 | Ga0466734_035321 | 3300042623 | Bacteria | 1404 |
| 75 | Ga0466735_108320 | 3300042624 | Bacteria | 1258 |
| 76 | Ga0466730_026722 | 3300042625 | Bacteria | 2125 |
| 77 | Ga0466703_003337 | 3300042636 | Bacteria | 39032 |
| 78 | Ga0466703_425360 | 3300042636 | Bacteria | 12584 |
| 79 | Ga0466725_460904 | 3300042654 | Bacteria | 5343 |
| 80 | Ga0466727_071548 | 3300042655 | Bacteria | 12054 |
| 81 | Ga0123356_10004926 | 3300010049 | Bacteria | 13697 |
| 82 | Ga0123356_10022056 | 3300010049 | Bacteria | 6013 |
| 83 | Ga0123356_10031957 | 3300010049 | Bacteria | 4926 |
| 84 | Ga0123356_10075298 | 3300010049 | Bacteria | 3179 |
| 85 | Ga0123353_10005215 | 3300010167 | Bacteria | 16994 |
| 86 | Ga0123353_10021793 | 3300010167 | Bacteria | 9630 |
| 87 | Ga0160464_100554 | 3300012805 | Unclassified | 25385 |
| 88 | Ga0466706_117156 | 3300042599 | Bacteria | 1576 |
| 89 | Ga0466706_129771 | 3300042599 | Bacteria | 8774 |
| 90 | Ga0466707_330396 | 3300042601 | Bacteria | 47158 |
| 91 | Ga0466707_395209 | 3300042601 | Bacteria | 17406 |
| 92 | Ga0466707_396379 | 3300042601 | Unclassified | 3134 |
| 93 | Ga0466713_153170 | 3300042602 | Bacteria | 4708 |
| 94 | Ga0466717_196093 | 3300042604 | Bacteria | 1442 |
| 95 | Ga0466696_040080 | 3300042596 | Bacteria | 3110 |
| 96 | Ga0466696_256481 | 3300042596 | Bacteria | 8286 |
| 97 | JGI24699J35502_11134207 | 3300002509 | Bacteria | 57914 |
| 98 | Ga0072940_1030850 | 3300005200 | Bacteria | 3730 |
| 99 | Ga0466723_205451 | 3300042618 | Bacteria | 6881 |
| 100 | Ga0466728_374049 | 3300042620 | Bacteria | 5731 |
| 101 | Ga0466704_306019 | 3300042643 | Bacteria | 2363 |
| 102 | Ga0466733_122819 | 3300042659 | Bacteria | 15525 |
| 103 | Ga0123357_10157295 | 3300009784 | Bacteria | 2737 |
| 104 | Ga0123354_10696024 | 3300010882 | Bacteria | 711 |
| 105 | Ga0160454_101067 | 3300012798 | Bacteria | 4712 |
| 106 | Ga0466707_068266 | 3300042601 | Bacteria | 1136 |
| 107 | Ga0466713_008814 | 3300042602 | Bacteria | 3015 |
| 108 | Ga0466713_018028 | 3300042602 | Bacteria | 58969 |
| 109 | Ga0466713_134185 | 3300042602 | Bacteria | 76621 |
| 110 | Ga0466657_250264 | 3300042582 | Bacteria | 6771 |
| 111 | Ga0466693_018687 | 3300042592 | Bacteria | 2035 |
| 112 | JGI24703J35330_11593691 | 3300002501 | Bacteria | 1350 |
| 113 | JGI24699J35502_11041337 | 3300002509 | Unclassified | 1578 |
| 114 | JGI24699J35502_11133764 | 3300002509 | Bacteria | 15028 |
| 115 | Ga0072941_1110964 | 3300005201 | Bacteria | 4908 |
| 116 | Ga0466705_366956 | 3300042612 | Bacteria | 2468 |
| 117 | Ga0466705_435679 | 3300042612 | Bacteria | 11633 |
| 118 | Ga0466715_318576 | 3300042616 | Bacteria | 2332 |
| 119 | Ga0466729_056668 | 3300042621 | Bacteria | 16891 |
| 120 | Ga0466734_123719 | 3300042623 | Bacteria | 4473 |
| 121 | Ga0466703_135101 | 3300042636 | Bacteria | 119691 |
| 122 | Ga0466703_320544 | 3300042636 | Bacteria | 27077 |
| 123 | Ga0466704_508228 | 3300042643 | Bacteria | 66197 |
| 124 | Ga0562378_0002 | 3300056814 | Bacteria | 3519472 |
| 125 | Ga0123357_10005137 | 3300009784 | Unclassified | 15611 |
| 126 | Ga0123357_10006717 | 3300009784 | Bacteria | 14101 |
| 127 | Ga0123357_10104360 | 3300009784 | Bacteria | 3640 |
| 128 | Ga0123356_10000101 | 3300010049 | Bacteria | 90121 |
| 129 | Ga0123356_11276076 | 3300010049 | Bacteria | 898 |
| 130 | Ga0123353_10001408 | 3300010167 | Bacteria | 29363 |
| 131 | Ga0123353_10158974 | 3300010167 | Bacteria | 3599 |
| 132 | Ga0123354_10032684 | 3300010882 | Bacteria | 8154 |
| 133 | Ga0466707_111815 | 3300042601 | Bacteria | 1766 |
| 134 | Ga0466713_102865 | 3300042602 | Bacteria | 21013 |
| 135 | Ga0466719_038416 | 3300042606 | Bacteria | 28108 |
| 136 | Ga0160440_107938 | 3300012815 | Bacteria | 956 |
| 137 | Ga0160443_100312 | 3300012848 | Bacteria | 45814 |
| 138 | Ga0160443_131629 | 3300012848 | Bacteria | 536 |
| 139 | Ga0160434_102561 | 3300012850 | Bacteria | 3141 |
| 140 | Ga0466693_316369 | 3300042592 | Bacteria | 138024 |
| 141 | JGI24699J35502_11133439 | 3300002509 | Unclassified | 10612 |
| 142 | Ga0466705_031327 | 3300042612 | Bacteria | 9441 |
| 143 | Ga0466723_012373 | 3300042618 | Bacteria | 16454 |
| 144 | Ga0466723_116676 | 3300042618 | Bacteria | 3115 |
| 145 | Ga0466723_163775 | 3300042618 | Bacteria | 11255 |
| 146 | Ga0466726_341022 | 3300042619 | Bacteria | 3619 |
| 147 | Ga0466728_052595 | 3300042620 | Bacteria | 2223 |
| 148 | Ga0466704_611761 | 3300042643 | Bacteria | 3270 |
| 149 | Ga0123354_10036765 | 3300010882 | Bacteria | 7633 |
| 150 | Ga0160442_104125 | 3300012806 | Unclassified | 1494 |
| 151 | Ga0466713_022907 | 3300042602 | Bacteria | 9737 |
| 152 | Ga0466714_034676 | 3300042603 | Unclassified | 2352 |
| 153 | Ga0466714_096067 | 3300042603 | Bacteria | 5200 |
| 154 | Ga0466714_098638 | 3300042603 | Bacteria | 1356 |
| 155 | Ga0466720_099638 | 3300042607 | Bacteria | 1469 |
| 156 | Ga0466698_262801 | 3300042610 | Bacteria | 1596 |
| 157 | Ga0160440_100031 | 3300012815 | Bacteria | 222224 |
| 158 | Ga0160440_103358 | 3300012815 | Unclassified | 1562 |
| 159 | Ga0160456_100686 | 3300012820 | Bacteria | 9677 |
| 160 | Ga0160447_100474 | 3300012849 | Bacteria | 19335 |
| 161 | Ga0160435_1000092 | 3300012857 | Bacteria | 52886 |
| 162 | Ga0466693_020933 | 3300042592 | Bacteria | 52412 |
| 163 | Ga0466696_314032 | 3300042596 | Bacteria | 2506 |
| 164 | Ga0466696_391243 | 3300042596 | Bacteria | 2320 |
| 165 | JGI24699J35502_11105894 | 3300002509 | Unclassified | 2508 |
| 166 | JGI24699J35502_11129847 | 3300002509 | Bacteria | 4858 |
| 167 | JGI24699J35502_11133604 | 3300002509 | Bacteria | 12425 |
| 168 | Ga0466705_147809 | 3300042612 | Bacteria | 1485 |
| 169 | Ga0466705_148370 | 3300042612 | Bacteria | 4211 |
| 170 | Ga0466723_119807 | 3300042618 | Bacteria | 5178 |
| 171 | Ga0466723_147701 | 3300042618 | Bacteria | 4716 |
| 172 | Ga0466729_228060 | 3300042621 | Bacteria | 1498 |
| 173 | Ga0466730_018821 | 3300042625 | Bacteria | 10921 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00380 | Ribosomal_S9 | Ribosomal protein S9/S16 | 63 | 184 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.