Protein Family IF12056

Metagenome Isolate
139 Members
42 Samples
124 Scaffolds
218.86 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820367663|2820369138|
Length
216 aa
Sequence
MSKIAPSLLAADALHLGREAGLAAGMGCDYFHLDIMDGVFVPNLSFGPHVLAGLRREVGAVYDVHLMVIDPLPFIDVFAENGADILTVHVEARHFEESLAKIRGLGLRAGASLRPGTQARAIEPYFNLLDLILVMTVEPGFGGQSFMADMLPKIRAIREYITQHGLDCELEVDGGVNPETAKLCIDAGANVLVAGSDVFGQADRVGRIEQLRTVGG

📊 Sample Types

Isolate 10.8%
Metagenome 89.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.2%
Unclassified 35.7%
Kalotermitidae 11.9%
Termopsidae 4.8%
Rhinotermitidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
7 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
8 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
9 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
13 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
14 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
15 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
16 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
17 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
26 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
30 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
31 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
36 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
37 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_154428 3300042601 Bacteria 101562
2 Ga0466707_236563 3300042601 Bacteria 2991
3 Ga0466693_369333 3300042592 Bacteria 1173
4 Ga0466699_120066 3300042597 Bacteria 1761
5 Ga0123355_10002906 3300009826 Bacteria 24334
6 Ga0123356_10008227 3300010049 Bacteria 10380
7 Ga0123356_10378270 3300010049 Bacteria 1548
8 Ga0123356_10658349 3300010049 Bacteria 1215
9 Ga0123356_11515257 3300010049 Unclassified 828
10 Ga0123353_10011197 3300010167 Bacteria 12616
11 Ga0123353_10051804 3300010167 Bacteria 6551
12 Ga0123353_10470961 3300010167 Bacteria 1842
13 Ga0123353_11087869 3300010167 Bacteria 1063
14 Ga0123354_10160165 3300010882 Unclassified 2676
15 Ga0123354_10245855 3300010882 Bacteria 1827
16 JGI24695J34938_10026085 3300002450 Bacteria 2781
17 JGI24702J35022_10002003 3300002462 Bacteria 12556
18 JGI24705J35276_12220865 3300002504 Bacteria 2295
19 Ga0466722_001883 3300042609 Bacteria 4121
20 Ga0466690_038287 3300042590 Bacteria 3727
21 Ga0123356_10010149 3300010049 Bacteria 9262
22 Ga0123356_10041855 3300010049 Bacteria 4269
23 Ga0123356_10292260 3300010049 Bacteria 1730
24 Ga0123356_10299000 3300010049 Bacteria 1714
25 Ga0123356_10773833 3300010049 Bacteria 1130
26 Ga0123353_10186690 3300010167 Bacteria 3278
27 Ga0123353_10813334 3300010167 Bacteria 1288
28 Ga0123353_11658709 3300010167 Unclassified 803
29 Ga0123354_10653989 3300010882 Unclassified 750
30 Ga0466707_061222 3300042601 Bacteria 6441
31 Ga0466719_484682 3300042606 Bacteria 3944
32 Ga0123357_10185201 3300009784 Bacteria 2418
33 Ga0123355_10000103 3300009826 Bacteria 93124
34 Ga0123355_10158944 3300009826 Bacteria 3410
35 Ga0123356_10113483 3300010049 Bacteria 2622
36 Ga0123356_10176567 3300010049 Bacteria 2153
37 Ga0123356_10374406 3300010049 Bacteria 1555
38 Ga0123356_10536535 3300010049 Bacteria 1330
39 Ga0123356_11135947 3300010049 Bacteria 949
40 Ga0123356_11408601 3300010049 Bacteria 857
41 Ga0123353_10153657 3300010167 Bacteria 3672
42 Ga0123353_10164551 3300010167 Bacteria 3528
43 Ga0123353_11755866 3300010167 Bacteria 774
44 Ga0466726_176702 3300042619 Bacteria 18406
45 Ga0466702_085278 3300042635 Bacteria 2806
46 Ga0466725_124122 3300042654 Bacteria 1023
47 JGI24702J35022_10000481 3300002462 Bacteria 24075
48 Ga0466733_099931 3300042659 Bacteria 1023
49 Ga0466696_009511 3300042596 Bacteria 19262
50 Ga0123355_10000345 3300009826 Bacteria 60128
51 Ga0123355_10000428 3300009826 Bacteria 55084
52 Ga0123355_10006430 3300009826 Bacteria 17404
53 Ga0123356_10078661 3300010049 Bacteria 3113
54 Ga0123356_10177692 3300010049 Bacteria 2147
55 Ga0123356_10179098 3300010049 Bacteria 2140
56 Ga0123353_10338517 3300010167 Bacteria 2273
57 Ga0123353_10523042 3300010167 Bacteria 1720
58 Ga0123354_10470426 3300010882 Bacteria 1002
59 Ga0466723_304467 3300042618 Bacteria 8274
60 Ga0466727_188399 3300042655 Bacteria 1811
61 JGI24695J34938_10001211 3300002450 Bacteria 22875
62 JGI24695J34938_10005074 3300002450 Bacteria 8368
63 Ga0466717_020566 3300042604 Bacteria 1151
64 Ga0415639_002379 3300038395 Bacteria 17171
65 Ga0123355_10046098 3300009826 Bacteria 7091
66 Ga0123356_10338674 3300010049 Bacteria 1624
67 Ga0123356_10606263 3300010049 Bacteria 1260
68 Ga0123353_10292963 3300010167 Bacteria 2490
69 Ga0123353_11028504 3300010167 Bacteria 1103
70 Ga0123353_11383692 3300010167 Bacteria 906
71 Ga0466734_065213 3300042623 Bacteria 1311
72 Ga0466707_085827 3300042601 Bacteria 2003
73 Ga0466707_306007 3300042601 Bacteria 8691
74 Ga0466721_045075 3300042608 Bacteria 1002
75 Ga0123355_10615096 3300009826 Bacteria 1283
76 Ga0123356_10018553 3300010049 Bacteria 6603
77 Ga0123356_10053279 3300010049 Bacteria 3765
78 Ga0123356_10245442 3300010049 Bacteria 1865
79 Ga0123356_10760459 3300010049 Bacteria 1139
80 Ga0123353_10128153 3300010167 Bacteria 4075
81 Ga0123353_10175022 3300010167 Bacteria 3403
82 Ga0123353_10177989 3300010167 Bacteria 3370
83 Ga0123353_10184596 3300010167 Bacteria 3299
84 Ga0123354_10296932 3300010882 Bacteria 1536
85 Ga0466702_005542 3300042635 Bacteria 1565
86 JGI24702J35022_10028662 3300002462 Bacteria 2991
87 Ga0466705_186213 3300042612 Bacteria 7704
88 Ga0466733_138800 3300042659 Bacteria 3606
89 Ga0466693_250246 3300042592 Bacteria 1300
90 Ga0466694_101807 3300042594 Bacteria 14300
91 Ga0123355_10012902 3300009826 Bacteria 12970
92 Ga0123355_10121106 3300009826 Bacteria 4058
93 Ga0123355_10208567 3300009826 Bacteria 2838
94 Ga0123355_10390199 3300009826 Bacteria 1805
95 Ga0123356_10000242 3300010049 Bacteria 62970
96 Ga0123356_10000703 3300010049 Bacteria 36998
97 Ga0123356_10163875 3300010049 Unclassified 2224
98 Ga0123356_10191109 3300010049 Bacteria 2078
99 Ga0123356_10223877 3300010049 Bacteria 1940
100 Ga0123356_10549486 3300010049 Bacteria 1316
101 Ga0123356_10891722 3300010049 Bacteria 1061
102 Ga0123356_11233126 3300010049 Bacteria 913
103 Ga0123356_11361361 3300010049 Bacteria 871
104 Ga0123353_10078284 3300010167 Bacteria 5314
105 Ga0123353_10200979 3300010167 Bacteria 3135
106 Ga0123353_10463754 3300010167 Bacteria 1860
107 Ga0123353_10920091 3300010167 Bacteria 1188
108 Ga0123354_10118002 3300010882 Bacteria 3448
109 Ga0466702_126641 3300042635 Bacteria 1245
110 Ga0466717_056180 3300042604 Bacteria 1422
111 Ga0123355_10086313 3300009826 Bacteria 4991
112 Ga0123355_10430665 3300009826 Bacteria 1678
113 Ga0123356_10020768 3300010049 Bacteria 6211
114 Ga0123356_10021754 3300010049 Bacteria 6053
115 Ga0123356_10034223 3300010049 Bacteria 4749
116 Ga0123356_10240817 3300010049 Bacteria 1880
117 Ga0123356_10265043 3300010049 Bacteria 1804
118 Ga0123353_10000753 3300010167 Bacteria 39300
119 Ga0123353_10319549 3300010167 Bacteria 2357
120 Ga0123353_11176300 3300010167 Bacteria 1009
121 Ga0466725_391341 3300042654 Bacteria 1568
122 JGI24702J35022_10001259 3300002462 Bacteria 15794
123 JGI24702J35022_10015518 3300002462 Bacteria 4191
124 JGI24702J35022_10015819 3300002462 Bacteria 4145

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family 3 199 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.