Protein Family IF12015

Metagenome Isolate
128 Members
46 Samples
108 Scaffolds
357.23 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820267566|2820268495|
Length
390 aa
Sequence
MKIGLIGLNQTGKTTLFELLSGRSGGGGSGGGGSGGGVSSGSSGSRGSSGGSGGTGIGGGDRKSASIGMGQVPDERVDILSAMYRPKKTTYAKIEFTDVAGFTASGDGGNAGAARFLNDVRPCDALIHVLRAFDSETVAHDLGDVDPARDLEAVEMEMLFADMEMLERRIGRLKAGKKISKDQTAEIGLLERCYAQLENGGAMSDMDMTEEELAVMQGYAFLTEKPRLAVVNLDERQWKAGDYHHRDELLALCAKLNMPLILLCVEMELEISRLADDDKKLFMDDLGIAQPGIAVLASAMYGLLGQISFFTVGEDEVRAWTIDKGSSARISAGKIHSDIERGFIRAEVVKYENLVELGSMAKVKEQGLFRLEGKEYIVADGDIISFRFNV

📊 Sample Types

Isolate 15.6%
Metagenome 84.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 46.7%
Termitidae 37.8%
Kalotermitidae 15.6%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
2 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 2820046858 Unclassified Proteobacteria Th196P3bin84 Isolate Unclassified
9 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
10 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
16 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 2820159668 Unclassified Proteobacteria Cu122P3bin5 Isolate Unclassified
19 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
20 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
21 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
22 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
23 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
24 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
27 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
28 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
31 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
32 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
33 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
34 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
35 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
36 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
39 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
40 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
41 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
44 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_050088 3300042616 Bacteria 2340
2 Ga0466715_459899 3300042616 Bacteria 2726
3 Ga0466721_076381 3300042608 Bacteria 1464
4 Ga0466703_034377 3300042636 Bacteria 24351
5 Ga0123357_10193814 3300009784 Bacteria 2333
6 Ga0123355_10000343 3300009826 Bacteria 60197
7 Ga0123355_10299867 3300009826 Unclassified 2192
8 Ga0123356_10002455 3300010049 Bacteria 19796
9 Ga0123356_10002782 3300010049 Bacteria 18566
10 Ga0123356_10052045 3300010049 Bacteria 3809
11 Ga0123356_10220417 3300010049 Bacteria 1953
12 Ga0123353_10015881 3300010167 Bacteria 10972
13 Ga0123353_10059217 3300010167 Bacteria 6141
14 Ga0123353_10067945 3300010167 Bacteria 5723
15 Ga0123353_10245206 3300010167 Bacteria 2780
16 Ga0123353_10255676 3300010167 Bacteria 2709
17 Ga0123353_10552604 3300010167 Bacteria 1660
18 Ga0123353_10554318 3300010167 Bacteria 1657
19 Ga0123353_10645184 3300010167 Bacteria 1500
20 Ga0466693_073071 3300042592 Bacteria 1913
21 JGI24702J35022_10000734 3300002462 Bacteria 20141
22 Ga0466705_067806 3300042612 Bacteria 1972
23 Ga0466711_096191 3300042615 Bacteria 3045
24 Ga0466704_164043 3300042643 Bacteria 1977
25 Ga0123356_10000614 3300010049 Bacteria 39394
26 Ga0123356_10066850 3300010049 Bacteria 3366
27 Ga0123356_10068832 3300010049 Bacteria 3317
28 Ga0123356_10237594 3300010049 Bacteria 1891
29 Ga0123356_10309103 3300010049 Bacteria 1689
30 Ga0123353_10000752 3300010167 Bacteria 39322
31 Ga0123353_10016644 3300010167 Bacteria 10755
32 Ga0123353_10159583 3300010167 Unclassified 3591
33 Ga0123353_10233294 3300010167 Bacteria 2866
34 Ga0123353_10612839 3300010167 Bacteria 1552
35 Ga0123353_10678841 3300010167 Bacteria 1451
36 Ga0123353_10711582 3300010167 Bacteria 1407
37 Ga0123354_10042898 3300010882 Bacteria 6964
38 Ga0466693_156327 3300042592 Bacteria 2556
39 Ga0466693_204249 3300042592 Bacteria 2238
40 Ga0466696_331268 3300042596 Bacteria 1950
41 Ga0466699_022206 3300042597 Bacteria 2399
42 JGI24702J35022_10026484 3300002462 Bacteria 3123
43 Ga0466705_331226 3300042612 Bacteria 4042
44 Ga0466733_044920 3300042659 Bacteria 2744
45 Ga0466718_167248 3300042617 Bacteria 1225
46 Ga0123355_10001422 3300009826 Bacteria 33423
47 Ga0123356_10000010 3300010049 Bacteria 220063
48 Ga0123353_10006564 3300010167 Bacteria 15514
49 Ga0123353_10011772 3300010167 Bacteria 12354
50 Ga0123353_10455606 3300010167 Unclassified 1882
51 JGI24705J35276_12208717 3300002504 Bacteria 1779
52 Ga0466700_405439 3300042600 Bacteria 1533
53 Ga0466707_112732 3300042601 Bacteria 3747
54 Ga0123355_10000064 3300009826 Bacteria 113151
55 Ga0123355_10002201 3300009826 Bacteria 27506
56 Ga0123355_10230970 3300009826 Unclassified 2642
57 Ga0123356_10063334 3300010049 Bacteria 3455
58 Ga0123353_10037192 3300010167 Bacteria 7633
59 Ga0123353_10837187 3300010167 Bacteria 1264
60 Ga0264413_163322 3300024493 Unclassified 1146
61 Ga0466694_344340 3300042594 Bacteria 3521
62 Ga0466717_270190 3300042604 Bacteria 1811
63 Ga0123355_10000015 3300009826 Bacteria 174406
64 Ga0123355_10002943 3300009826 Bacteria 24196
65 Ga0123356_10039296 3300010049 Bacteria 4409
66 Ga0123356_10040435 3300010049 Bacteria 4344
67 Ga0123356_10078099 3300010049 Bacteria 3124
68 Ga0123356_10235327 3300010049 Bacteria 1899
69 Ga0123356_10536913 3300010049 Bacteria 1329
70 Ga0123353_10008205 3300010167 Bacteria 14225
71 Ga0123353_10109241 3300010167 Bacteria 4456
72 Ga0123353_10264178 3300010167 Bacteria 2656
73 Ga0123353_10286880 3300010167 Bacteria 2523
74 Ga0123353_10797405 3300010167 Bacteria 1305
75 Ga0123353_10830398 3300010167 Bacteria 1270
76 Ga0123354_10158337 3300010882 Bacteria 2704
77 Ga0123354_10165005 3300010882 Bacteria 2608
78 JGI24702J35022_10018533 3300002462 Bacteria 3794
79 Ga0466719_548180 3300042606 Bacteria 5564
80 Ga0123355_10266369 3300009826 Bacteria 2388
81 Ga0123356_10000741 3300010049 Bacteria 36002
82 Ga0123356_10004590 3300010049 Bacteria 14241
83 Ga0123356_10020476 3300010049 Bacteria 6259
84 Ga0123356_10021345 3300010049 Bacteria 6112
85 Ga0123356_10169789 3300010049 Bacteria 2190
86 Ga0123353_10204520 3300010167 Bacteria 3103
87 Ga0123353_10285845 3300010167 Bacteria 2529
88 Ga0123353_10339799 3300010167 Bacteria 2268
89 Ga0466704_504124 3300042643 Bacteria 5059
90 Ga0123356_10011758 3300010049 Bacteria 8521
91 Ga0123356_10011895 3300010049 Bacteria 8470
92 Ga0123353_10322276 3300010167 Bacteria 2344
93 Ga0123354_10076573 3300010882 Bacteria 4773
94 Ga0466657_381089 3300042582 Bacteria 1961
95 JGI24695J34938_10000002 3300002450 Bacteria 261916
96 JGI24702J35022_10000025 3300002462 Bacteria 59634
97 JGI24702J35022_10001752 3300002462 Bacteria 13417
98 Ga0466705_469703 3300042612 Bacteria 5431
99 Ga0123355_10001386 3300009826 Bacteria 33785
100 Ga0123355_10080357 3300009826 Bacteria 5206
101 Ga0123356_10006327 3300010049 Bacteria 11955
102 Ga0123356_10049437 3300010049 Bacteria 3914
103 Ga0123356_10243953 3300010049 Bacteria 1869
104 Ga0123353_10080602 3300010167 Bacteria 5235
105 Ga0123353_10126778 3300010167 Bacteria 4102
106 Ga0123353_10497265 3300010167 Bacteria 1778
107 Ga0466693_099938 3300042592 Bacteria 3506
108 Ga0466693_133194 3300042592 Bacteria 1569

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06071 YchF-GTPase_C Protein of unknown function (DUF933) 307 389 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.