Protein Family IF11944

Metagenome Isolate
140 Members
74 Samples
102 Scaffolds
650.99 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820111668|2820112383|
Length
735 aa
Sequence
MASFSRTVQTTDSERLAKGATKSPASPFKLSSHYEPKGDQPQAIEKLLLGLAQGDQHQVLLGITGSGKTFTVANVIAKVGRPTLIIAPNKTLAAQLYGEMKELFPENAVEYFVSYYDYYQPEAYVPTSDTYIDKDAIVNDQIDRMRHAATRALLSRHDVIIVASVSCIYGIGSAESYQGLLIDLSVNEEFRRDNLLRMLVDIQYERNDIDFHRGTFRVRGDIVEVFPAYESDTAVRIEFFGDTIEAIKEVDPIRGRVKDSLDRYAIFPGSHYVTPQEQMRRAIVEIRDELRDRLDFFDKEGRFLEKQRLEQRTLYDIEMMEQMGFCNGIENYSRHLSGRKAEEPPPTLVDYFPKDFLLILDESHQTVPQIGAMFRGDRARKETLVEYGFRLPSALDNRPLKFEEFEQHIHRCIHVSATPGDYELGRAQGAFVEQVIRPTGLMDPVVEVRPVAGQVDDLLVEIRDRASKNERVLCTTLTKRMAEDLTDYYRELGVRIRYLHSDIDTLERIDILRDLRLGEFDVLVGINLLREGLDLPEVSLVAIFDADKEGFLRSPRSLIQTIGRAARNVSGRVIMYADSITPAMKNAIDETNRRRVIQEKYNTEHGIIPATVIRAVMNINPASGTMDYFEIPKVPKAGGKGGKGDRAPINVSEQIPSMRAEMFTAAENLEFERAAKLRDEIKRLEALAGDSSSVDAGDIGYDPYAAAPKRKSAKTSRTSRASPTKKTGARGRWKR

📊 Sample Types

Isolate 27.1%
Metagenome 72.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 50.0%
Termitidae 23.0%
Kalotermitidae 12.2%
Termopsidae 4.1%
Formicidae 2.7%
Rhinotermitidae 2.7%
Vespidae 1.4%
Apidae 1.4%
Dytiscidae 1.4%
Passalidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
2 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
3 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
4 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
5 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
11 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
16 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
17 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
20 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
21 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
22 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
23 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 3003178663 Psychrobacter fulvigenes KC-40 Isolate Unclassified
31 3006156446 Acinetobacter baretiae B10A Isolate Apidae
32 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
33 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
34 2820106212 Unclassified Proteobacteria Emb289P4bin44 Isolate Unclassified
35 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
36 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
37 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
38 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
39 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
40 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
41 2820155744 Unclassified Proteobacteria Cu122P5bin24 Isolate Unclassified
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
44 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
45 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
51 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
52 2820111668 Unclassified Proteobacteria Emb289P4bin34 Isolate Unclassified
53 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
54 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
55 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
56 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
57 2820400448 Unclassified Firmicutes Nc150Mbin1 Isolate Unclassified
58 2987233858 Stutzerimonas stutzeri AR9-4 Isolate Unclassified
59 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
60 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
61 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
62 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
63 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
64 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
65 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
66 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
67 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
68 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
69 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
70 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
71 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
72 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
73 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
74 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24695J34938_10001118 3300002450 Bacteria 24171
2 JGI24702J35022_10006350 3300002462 Bacteria 6834
3 Ga0123355_10000913 3300009826 Bacteria 40903
4 Ga0123355_10003376 3300009826 Bacteria 22874
5 Ga0123355_10027403 3300009826 Bacteria 9203
6 Ga0123356_10000405 3300010049 Bacteria 49129
7 Ga0123353_10000511 3300010167 Bacteria 48051
8 Ga0123353_10022105 3300010167 Bacteria 9573
9 Ga0123353_10309810 3300010167 Bacteria 2404
10 Ga0466728_335614 3300042620 Bacteria 10430
11 Ga0466716_099578 3300042605 Bacteria 3093
12 Ga0466721_037876 3300042608 Unclassified 7090
13 Ga0466721_171557 3300042608 Bacteria 3315
14 JGI24695J34938_10003731 3300002450 Bacteria 10405
15 Ga0123355_10000759 3300009826 Bacteria 44075
16 Ga0123355_10002475 3300009826 Bacteria 26149
17 Ga0123356_10033956 3300010049 Bacteria 4771
18 Ga0123356_10093394 3300010049 Bacteria 2871
19 Ga0123356_10108100 3300010049 Bacteria 2681
20 Ga0466697_121715 3300042611 Bacteria 2766
21 Ga0466700_210474 3300042600 Bacteria 75558
22 2227219689 2225789004 Bacteria 32782
23 Ga0123356_10002283 3300010049 Bacteria 20651
24 Ga0123356_10035969 3300010049 Bacteria 4624
25 Ga0123356_10080722 3300010049 Bacteria 3076
26 Ga0123353_10193211 3300010167 Bacteria 3210
27 Ga0466735_180902 3300042624 Bacteria 56754
28 Ga0466725_048442 3300042654 Bacteria 2463
29 Ga0466707_039662 3300042601 Bacteria 10567
30 Ga0466707_047035 3300042601 Bacteria 25395
31 Ga0466707_106253 3300042601 Bacteria 108878
32 Ga0466713_116879 3300042602 Bacteria 19083
33 Ga0466714_150935 3300042603 Bacteria 85449
34 Ga0466721_294824 3300042608 Bacteria 3799
35 Ga0466722_105882 3300042609 Bacteria 8946
36 Ga0466732_376663 3300042656 Bacteria 38993
37 CVPL010W_10004428 3300002931 Bacteria 15584
38 Ga0123357_10000084 3300009784 Bacteria 75651
39 Ga0415639_020119 3300038395 Bacteria 10047
40 Ga0466690_154811 3300042590 Bacteria 17895
41 Ga0466693_090723 3300042592 Bacteria 3783
42 Ga0466691_058352 3300042593 Bacteria 18356
43 Ga0123355_10001594 3300009826 Bacteria 31632
44 Ga0123355_10002415 3300009826 Bacteria 26398
45 Ga0123356_10008219 3300010049 Bacteria 10384
46 Ga0123356_10118041 3300010049 Bacteria 2575
47 Ga0123353_10011952 3300010167 Bacteria 12281
48 Ga0123353_10091841 3300010167 Unclassified 4890
49 Ga0123353_10328830 3300010167 Bacteria 2315
50 Ga0123353_10339448 3300010167 Bacteria 2269
51 Ga0466729_012995 3300042621 Bacteria 9162
52 Ga0466707_273324 3300042601 Bacteria 19540
53 Ga0466714_019530 3300042603 Bacteria 14374
54 JGI24695J34938_10020158 3300002450 Unclassified 3286
55 Ga0123355_10000068 3300009826 Bacteria 110792
56 Ga0123356_10010255 3300010049 Bacteria 9214
57 Ga0123356_10010391 3300010049 Bacteria 9136
58 Ga0123356_10048424 3300010049 Bacteria 3956
59 Ga0123356_10055238 3300010049 Unclassified 3699
60 Ga0123353_10003478 3300010167 Bacteria 19905
61 Ga0123353_10045660 3300010167 Bacteria 6955
62 Ga0123353_10051184 3300010167 Bacteria 6590
63 Ga0123353_10228332 3300010167 Bacteria 2904
64 Ga0466714_143709 3300042603 Bacteria 12218
65 Ga0466722_218979 3300042609 Bacteria 21124
66 CVPL005W_1000236 3300002934 Bacteria 24542
67 Ga0123355_10204825 3300009826 Bacteria 2873
68 Ga0123356_10000010 3300010049 Bacteria 220063
69 Ga0123356_10001848 3300010049 Bacteria 22947
70 Ga0123356_10001891 3300010049 Bacteria 22696
71 Ga0123353_10006247 3300010167 Bacteria 15839
72 Ga0123353_10043731 3300010167 Bacteria 7097
73 Ga0123353_10184147 3300010167 Bacteria 3303
74 Ga0466715_343453 3300042616 Bacteria 22114
75 Ga0466733_094048 3300042659 Bacteria 3765
76 Ga0123357_10000069 3300009784 Bacteria 84342
77 Ga0466690_042053 3300042590 Bacteria 23081
78 Ga0466696_180269 3300042596 Bacteria 4131
79 Ga0123355_10017997 3300009826 Bacteria 11190
80 Ga0123355_10028815 3300009826 Bacteria 8981
81 Ga0123356_10056959 3300010049 Bacteria 3642
82 Ga0123353_10114386 3300010167 Bacteria 4344
83 Ga0123354_10204942 3300010882 Bacteria 2153
84 Ga0466730_037491 3300042625 Bacteria 1958
85 Ga0466727_245681 3300042655 Bacteria 65513
86 Ga0466705_474281 3300042612 Bacteria 9022
87 Ga0466715_115573 3300042616 Bacteria 6967
88 Ga0466726_233550 3300042619 Bacteria 17997
89 Ga0123357_10000210 3300009784 Bacteria 54869
90 Ga0415639_001085 3300038395 Bacteria 60940
91 Ga0123355_10037425 3300009826 Bacteria 7890
92 Ga0123356_10003018 3300010049 Bacteria 17778
93 Ga0123356_10017812 3300010049 Bacteria 6748
94 Ga0123356_10036488 3300010049 Bacteria 4590
95 Ga0123356_10089964 3300010049 Bacteria 2921
96 Ga0123356_10102433 3300010049 Unclassified 2748
97 Ga0123353_10114114 3300010167 Bacteria 4349
98 Ga0123353_10199189 3300010167 Bacteria 3152
99 Ga0123354_10084234 3300010882 Unclassified 4467
100 Ga0466703_150166 3300042636 Bacteria 26236
101 Ga0466708_176529 3300042652 Bacteria 8576
102 Ga0466726_173114 3300042619 Bacteria 17281

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17757 UvrB_inter UvrB interaction domain 182 272 0.99
PF12344 UvrB Ultra-violet resistance protein B 575 616 0.98
PF02151 UVR UvrB/uvrC motif 653 686 0.94
PF00271 Helicase_C Helicase conserved C-terminal domain 458 568 0.9
PF04851 ResIII Type III restriction enzyme, res subunit 35 110 0.83
PF00270 DEAD DEAD/DEAH box helicase 39 107 0.82

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02151 GO:0005515 protein binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.