Protein Family IF11925
Metagenome
Isolate
222
Members
58
Samples
203
Scaffolds
392.11
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820020240|2820021146|
- Length
- 444 aa
- Sequence
- MNRKFTDVFFKHLFSIVALFSVLALGAILLFVFVHGSIPFFVPTSPDIRLXAQRIDELTVNGVEYIDHSTFINIPKNTDVISIKFPVSGMLWEDDDEXYDDDYEEEDYENEDNVDYDDSDYASYEEADEYDDYDEKTYEETLEIVINQNEKDPEKKLTFICGEDVKVTYPESYVYTVSWPAAISALEKRIHVILPEPPYSFGRXLTGLQWHXSRDKIYGIFPMIAGTLLASFGAILLGVXVALLCALFMSEFLPLKLASVARAGIEMLAGIPSVVYGFFGLMVIVPFIKSTFNVPSGNTLLSAIIVLALMILPTVITXXETSLRAVPLEVREASLALGASKMQTAWRVVLPHANSXVIAGIILGISRAVGETMAVIXVAGNSXQLTXNPLASIRTLTSTIXMEMGYASGRHSEMLFSIGVTLFIIILILNSLILWYRRRMEQEL
Sample Types
Isolate
8.6%
Metagenome
91.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Unclassified
30.4%
Kalotermitidae
23.2%
Rhinotermitidae
3.6%
Taxonomy
Archaea
0
Bacteria
211
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 12 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 13 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 14 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 15 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 31 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 32 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 40 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 43 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 44 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 45 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 46 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 52 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 53 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 54 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 55 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 56 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 57 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 58 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_068501 | 3300042612 | Bacteria | 16865 |
| 2 | Ga0466732_123457 | 3300042656 | Bacteria | 1563 |
| 3 | Ga0466732_152703 | 3300042656 | Bacteria | 7013 |
| 4 | Ga0466708_408137 | 3300042652 | Bacteria | 19449 |
| 5 | Ga0123356_10005940 | 3300010049 | Bacteria | 12391 |
| 6 | Ga0264413_102956 | 3300024493 | Bacteria | 4454 |
| 7 | Ga0415639_005305 | 3300038395 | Bacteria | 16909 |
| 8 | Ga0415639_031475 | 3300038395 | Bacteria | 6713 |
| 9 | Ga0466693_034950 | 3300042592 | Bacteria | 1713 |
| 10 | Ga0466693_272908 | 3300042592 | Bacteria | 38745 |
| 11 | AustNasuHG_c1009637 | 3300000089 | Bacteria | 3384 |
| 12 | JGI24698J34947_10003481 | 3300002449 | Bacteria | 8542 |
| 13 | JGI24695J34938_10024576 | 3300002450 | Bacteria | 2892 |
| 14 | Ga0072941_1075284 | 3300005201 | Bacteria | 2817 |
| 15 | Ga0072941_1121765 | 3300005201 | Bacteria | 1793 |
| 16 | Ga0074263_103272 | 3300005485 | Bacteria | 1438 |
| 17 | Ga0074263_113014 | 3300005485 | Bacteria | 4185 |
| 18 | Ga0466712_015925 | 3300042614 | Bacteria | 11922 |
| 19 | Ga0466712_021239 | 3300042614 | Bacteria | 11782 |
| 20 | Ga0466712_121516 | 3300042614 | Bacteria | 3369 |
| 21 | Ga0466712_183286 | 3300042614 | Bacteria | 15136 |
| 22 | Ga0466711_001519 | 3300042615 | Bacteria | 36988 |
| 23 | Ga0466711_067350 | 3300042615 | Bacteria | 9913 |
| 24 | Ga0466718_037580 | 3300042617 | Bacteria | 5402 |
| 25 | Ga0466717_194607 | 3300042604 | Bacteria | 2151 |
| 26 | Ga0466716_246398 | 3300042605 | Bacteria | 5630 |
| 27 | Ga0466720_052911 | 3300042607 | Bacteria | 5009 |
| 28 | Ga0466720_080343 | 3300042607 | Bacteria | 15819 |
| 29 | Ga0466720_099143 | 3300042607 | Unclassified | 3134 |
| 30 | Ga0466720_115567 | 3300042607 | Bacteria | 8267 |
| 31 | Ga0466702_123252 | 3300042635 | Bacteria | 9310 |
| 32 | Ga0466704_477329 | 3300042643 | Bacteria | 7960 |
| 33 | Ga0123356_10003195 | 3300010049 | Bacteria | 17219 |
| 34 | Ga0123356_10004321 | 3300010049 | Bacteria | 14697 |
| 35 | Ga0123356_10005713 | 3300010049 | Bacteria | 12635 |
| 36 | Ga0123356_10008085 | 3300010049 | Bacteria | 10473 |
| 37 | Ga0466694_005840 | 3300042594 | Bacteria | 106514 |
| 38 | Ga0466694_036096 | 3300042594 | Bacteria | 7424 |
| 39 | Ga0466699_228025 | 3300042597 | Bacteria | 6350 |
| 40 | JGI24698J34947_10001106 | 3300002449 | Bacteria | 13894 |
| 41 | JGI24698J34947_10005998 | 3300002449 | Unclassified | 6668 |
| 42 | JGI24697J35500_11273592 | 3300002507 | Bacteria | 5803 |
| 43 | Ga0072941_1002396 | 3300005201 | Bacteria | 20668 |
| 44 | Ga0466712_059856 | 3300042614 | Bacteria | 35187 |
| 45 | Ga0466701_063335 | 3300042598 | Bacteria | 1459 |
| 46 | Ga0466719_377405 | 3300042606 | Bacteria | 15588 |
| 47 | Ga0466720_017016 | 3300042607 | Unclassified | 8594 |
| 48 | Ga0466721_313968 | 3300042608 | Bacteria | 20613 |
| 49 | Ga0466732_393270 | 3300042656 | Bacteria | 2620 |
| 50 | Ga0123356_10000299 | 3300010049 | Bacteria | 57073 |
| 51 | Ga0123356_10002033 | 3300010049 | Bacteria | 21839 |
| 52 | Ga0123356_10058742 | 3300010049 | Unclassified | 3587 |
| 53 | Ga0466692_000604 | 3300042591 | Bacteria | 5406 |
| 54 | Ga0466693_028114 | 3300042592 | Bacteria | 110002 |
| 55 | Ga0466694_052650 | 3300042594 | Bacteria | 20998 |
| 56 | JGI24698J34947_10007146 | 3300002449 | Bacteria | 6135 |
| 57 | JGI24698J34947_10026600 | 3300002449 | Bacteria | 3074 |
| 58 | JGI24695J34938_10005716 | 3300002450 | Bacteria | 7674 |
| 59 | Ga0072940_1027796 | 3300005200 | Bacteria | 3802 |
| 60 | Ga0072941_1014135 | 3300005201 | Bacteria | 4308 |
| 61 | Ga0072941_1028753 | 3300005201 | Bacteria | 17830 |
| 62 | Ga0466712_000555 | 3300042614 | Unclassified | 6675 |
| 63 | Ga0466712_285453 | 3300042614 | Bacteria | 11443 |
| 64 | Ga0466711_103257 | 3300042615 | Bacteria | 20144 |
| 65 | Ga0466718_120716 | 3300042617 | Bacteria | 5164 |
| 66 | Ga0466728_170570 | 3300042620 | Bacteria | 3007 |
| 67 | Ga0466700_447284 | 3300042600 | Bacteria | 1885 |
| 68 | Ga0466720_059050 | 3300042607 | Bacteria | 4179 |
| 69 | Ga0466708_017794 | 3300042652 | Bacteria | 11629 |
| 70 | Ga0466708_114331 | 3300042652 | Bacteria | 7788 |
| 71 | Ga0466708_119761 | 3300042652 | Bacteria | 5167 |
| 72 | Ga0123356_10000999 | 3300010049 | Bacteria | 31384 |
| 73 | Ga0264413_117454 | 3300024493 | Bacteria | 4047 |
| 74 | Ga0466692_169137 | 3300042591 | Bacteria | 4872 |
| 75 | Ga0466692_182376 | 3300042591 | Bacteria | 6508 |
| 76 | Ga0466691_158366 | 3300042593 | Bacteria | 7798 |
| 77 | Ga0466694_024253 | 3300042594 | Bacteria | 20540 |
| 78 | JGI24698J34947_10009835 | 3300002449 | Bacteria | 5245 |
| 79 | JGI24698J34947_10020555 | 3300002449 | Unclassified | 3554 |
| 80 | JGI24698J34947_10020757 | 3300002449 | Bacteria | 3537 |
| 81 | JGI24695J34938_10000935 | 3300002450 | Bacteria | 26639 |
| 82 | JGI24695J34938_10003138 | 3300002450 | Bacteria | 11769 |
| 83 | Ga0072941_1002429 | 3300005201 | Bacteria | 39736 |
| 84 | Ga0072941_1003272 | 3300005201 | Bacteria | 13396 |
| 85 | Ga0072941_1018360 | 3300005201 | Bacteria | 13367 |
| 86 | Ga0074263_101293 | 3300005485 | Bacteria | 4007 |
| 87 | Ga0466711_330658 | 3300042615 | Bacteria | 2669 |
| 88 | Ga0466718_033184 | 3300042617 | Bacteria | 15825 |
| 89 | Ga0466716_335328 | 3300042605 | Bacteria | 10635 |
| 90 | Ga0466705_094242 | 3300042612 | Bacteria | 12722 |
| 91 | Ga0466702_100956 | 3300042635 | Bacteria | 39373 |
| 92 | Ga0466709_316324 | 3300042648 | Bacteria | 2314 |
| 93 | Ga0123356_10033779 | 3300010049 | Bacteria | 4784 |
| 94 | Ga0123356_10040637 | 3300010049 | Bacteria | 4333 |
| 95 | Ga0466694_143437 | 3300042594 | Bacteria | 2027 |
| 96 | Ga0466696_212544 | 3300042596 | Bacteria | 2654 |
| 97 | Ga0466699_180575 | 3300042597 | Bacteria | 1881 |
| 98 | AustNasuHG_c1000144 | 3300000089 | Bacteria | 22319 |
| 99 | AustNasuHG_c1006968 | 3300000089 | Bacteria | 4028 |
| 100 | JGI24695J34938_10000035 | 3300002450 | Bacteria | 102136 |
| 101 | JGI24695J34938_10002750 | 3300002450 | Bacteria | 12940 |
| 102 | JGI24695J34938_10012382 | 3300002450 | Bacteria | 4522 |
| 103 | JGI24695J34938_10015375 | 3300002450 | Bacteria | 3928 |
| 104 | JGI24695J34938_10037339 | 3300002450 | Bacteria | 2208 |
| 105 | Ga0072941_1002394 | 3300005201 | Bacteria | 13768 |
| 106 | Ga0072941_1006567 | 3300005201 | Bacteria | 21410 |
| 107 | Ga0466712_008558 | 3300042614 | Bacteria | 10675 |
| 108 | Ga0466712_018438 | 3300042614 | Bacteria | 2345 |
| 109 | Ga0466712_298591 | 3300042614 | Bacteria | 10678 |
| 110 | Ga0466715_081043 | 3300042616 | Bacteria | 8728 |
| 111 | Ga0466718_045669 | 3300042617 | Bacteria | 6335 |
| 112 | Ga0466718_057716 | 3300042617 | Bacteria | 8922 |
| 113 | Ga0466718_142630 | 3300042617 | Bacteria | 1718 |
| 114 | Ga0466716_297812 | 3300042605 | Bacteria | 3058 |
| 115 | Ga0466720_027749 | 3300042607 | Bacteria | 6026 |
| 116 | Ga0466720_222083 | 3300042607 | Unclassified | 3161 |
| 117 | Ga0466732_169638 | 3300042656 | Bacteria | 2427 |
| 118 | Ga0466731_012920 | 3300042622 | Bacteria | 154202 |
| 119 | Ga0466702_218285 | 3300042635 | Bacteria | 19292 |
| 120 | Ga0466702_459393 | 3300042635 | Bacteria | 1788 |
| 121 | Ga0466708_102890 | 3300042652 | Bacteria | 21227 |
| 122 | Ga0466708_112549 | 3300042652 | Bacteria | 1601 |
| 123 | Ga0123356_10002571 | 3300010049 | Bacteria | 19353 |
| 124 | Ga0123356_10014331 | 3300010049 | Bacteria | 7626 |
| 125 | Ga0123356_10014814 | 3300010049 | Bacteria | 7488 |
| 126 | Ga0123353_10060205 | 3300010167 | Unclassified | 6089 |
| 127 | Ga0264413_102957 | 3300024493 | Bacteria | 2951 |
| 128 | Ga0466699_066428 | 3300042597 | Bacteria | 5342 |
| 129 | Ga0466699_268122 | 3300042597 | Bacteria | 3584 |
| 130 | AustNasuHG_c1002947 | 3300000089 | Bacteria | 6131 |
| 131 | AustNasuHG_c1008050 | 3300000089 | Bacteria | 3735 |
| 132 | JGI24698J34947_10000067 | 3300002449 | Bacteria | 32875 |
| 133 | JGI24698J34947_10041240 | 3300002449 | Bacteria | 2378 |
| 134 | JGI24695J34938_10000098 | 3300002450 | Bacteria | 76790 |
| 135 | JGI24695J34938_10000369 | 3300002450 | Bacteria | 44536 |
| 136 | Ga0072941_1059661 | 3300005201 | Bacteria | 4304 |
| 137 | Ga0072941_1138958 | 3300005201 | Bacteria | 3190 |
| 138 | Ga0074263_113384 | 3300005485 | Bacteria | 1532 |
| 139 | Ga0466712_224330 | 3300042614 | Unclassified | 11429 |
| 140 | Ga0466723_114181 | 3300042618 | Bacteria | 4072 |
| 141 | Ga0466719_071293 | 3300042606 | Bacteria | 1940 |
| 142 | Ga0466720_122506 | 3300042607 | Bacteria | 2936 |
| 143 | Ga0466720_129874 | 3300042607 | Bacteria | 9649 |
| 144 | Ga0466722_070145 | 3300042609 | Bacteria | 18780 |
| 145 | Ga0466703_110457 | 3300042636 | Bacteria | 13852 |
| 146 | Ga0466709_320356 | 3300042648 | Bacteria | 9795 |
| 147 | Ga0466708_099906 | 3300042652 | Bacteria | 39915 |
| 148 | Ga0466708_365027 | 3300042652 | Bacteria | 4283 |
| 149 | Ga0123356_10021016 | 3300010049 | Unclassified | 6174 |
| 150 | Ga0466692_031291 | 3300042591 | Bacteria | 27627 |
| 151 | Ga0466692_151326 | 3300042591 | Bacteria | 19337 |
| 152 | Ga0466694_089443 | 3300042594 | Bacteria | 8323 |
| 153 | Ga0466694_207034 | 3300042594 | Bacteria | 2507 |
| 154 | Ga0466699_124136 | 3300042597 | Bacteria | 3984 |
| 155 | Ga0466699_148910 | 3300042597 | Bacteria | 1644 |
| 156 | Ga0466699_439410 | 3300042597 | Bacteria | 2354 |
| 157 | AustNasuHG_c1002869 | 3300000089 | Bacteria | 6225 |
| 158 | AustNasuHG_c1002957 | 3300000089 | Bacteria | 6121 |
| 159 | Ga0072941_1006601 | 3300005201 | Bacteria | 4621 |
| 160 | Ga0072941_1009209 | 3300005201 | Bacteria | 4943 |
| 161 | Ga0072941_1033337 | 3300005201 | Bacteria | 11508 |
| 162 | Ga0072941_1038715 | 3300005201 | Bacteria | 2135 |
| 163 | Ga0072941_1052254 | 3300005201 | Bacteria | 1687 |
| 164 | Ga0466712_028680 | 3300042614 | Bacteria | 4216 |
| 165 | Ga0466718_080283 | 3300042617 | Bacteria | 3782 |
| 166 | Ga0466719_171770 | 3300042606 | Bacteria | 28729 |
| 167 | Ga0466720_142060 | 3300042607 | Bacteria | 3573 |
| 168 | Ga0466721_162213 | 3300042608 | Bacteria | 3519 |
| 169 | Ga0466698_012103 | 3300042610 | Bacteria | 1453 |
| 170 | Ga0466705_167823 | 3300042612 | Bacteria | 13302 |
| 171 | Ga0466732_303487 | 3300042656 | Bacteria | 11255 |
| 172 | Ga0466731_092789 | 3300042622 | Bacteria | 3050 |
| 173 | Ga0466702_036543 | 3300042635 | Bacteria | 2757 |
| 174 | Ga0123356_10000349 | 3300010049 | Bacteria | 53319 |
| 175 | Ga0123356_10124165 | 3300010049 | Bacteria | 2517 |
| 176 | Ga0123353_10741297 | 3300010167 | Bacteria | 1369 |
| 177 | Ga0264413_110967 | 3300024493 | Bacteria | 2019 |
| 178 | Ga0466694_006403 | 3300042594 | Bacteria | 53277 |
| 179 | Ga0466695_068957 | 3300042595 | Bacteria | 62949 |
| 180 | Ga0466699_052562 | 3300042597 | Bacteria | 9226 |
| 181 | Ga0466699_070030 | 3300042597 | Bacteria | 21782 |
| 182 | Ga0466699_081058 | 3300042597 | Bacteria | 20204 |
| 183 | Ga0466699_182753 | 3300042597 | Bacteria | 2613 |
| 184 | AustNasuHG_c1004235 | 3300000089 | Bacteria | 5150 |
| 185 | JGI24698J34947_10004050 | 3300002449 | Bacteria | 7962 |
| 186 | JGI24698J34947_10017644 | 3300002449 | Bacteria | 3865 |
| 187 | JGI24698J34947_10030155 | 3300002449 | Bacteria | 2861 |
| 188 | JGI24698J34947_10061405 | 3300002449 | Unclassified | 1850 |
| 189 | JGI24695J34938_10000368 | 3300002450 | Bacteria | 44588 |
| 190 | JGI24695J34938_10001867 | 3300002450 | Bacteria | 17119 |
| 191 | JGI24695J34938_10004340 | 3300002450 | Bacteria | 9341 |
| 192 | Ga0072940_1027797 | 3300005200 | Bacteria | 5524 |
| 193 | Ga0072940_1029838 | 3300005200 | Bacteria | 3537 |
| 194 | Ga0072941_1002428 | 3300005201 | Bacteria | 2853 |
| 195 | Ga0072941_1009285 | 3300005201 | Bacteria | 25402 |
| 196 | Ga0466711_016357 | 3300042615 | Bacteria | 16773 |
| 197 | Ga0466715_065498 | 3300042616 | Bacteria | 1960 |
| 198 | Ga0466718_052515 | 3300042617 | Bacteria | 9284 |
| 199 | Ga0466718_057114 | 3300042617 | Bacteria | 6416 |
| 200 | Ga0466718_143443 | 3300042617 | Bacteria | 1359 |
| 201 | Ga0466723_173320 | 3300042618 | Bacteria | 3515 |
| 202 | Ga0466728_148113 | 3300042620 | Bacteria | 8996 |
| 203 | Ga0466722_105401 | 3300042609 | Bacteria | 4522 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 244 | 441 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.