Protein Family IF11920
Metagenome
Isolate
132
Members
41
Samples
118
Scaffolds
255.36
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2819998259|2819998929|
- Length
- 290 aa
- Sequence
- MKLLRNDLCWCGSGKKYKKCHMESDALSGTPKKIIAPKGIKIKNSEEIAGIAKCCKLTGNILDMLDEKITEGITTNDINELVHDYTIRHGAIPATLGYNGFPKSVCTSLNNVICHGIPDSTVLKNGDIINVDVTSILNGYYGDANRMYMIGEVSAEAKKLVRVTRECLYMAIEQVKPYNDFGKIGEVIQKHADKNGFSVVRDYGGHGIGLNFHEEPHVHHYNVGYRGLHMFPGMIFTIEPMINAGKYQTKLLKDGWTAVTIDGLLSAQWEHTICVTEKGADILTLTSKEK
Sample Types
Isolate
6.1%
Metagenome
93.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.0%
Termitidae
30.0%
Chrysomelidae
17.5%
Unclassified
7.5%
Termopsidae
5.0%
Hodotermitidae
2.5%
Rhinotermitidae
2.5%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2998827899 | Enterobacteriaceae endosymbiont of Donacia cincticornis DcincSym | Isolate | Chrysomelidae |
| 19 | 2998834864 | Enterobacteriaceae endosymbiont of Donacia bicoloricornis DbicSym | Isolate | Chrysomelidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 28 | 2998831604 | Enterobacteriaceae endosymbiont of Donacia thalassina DthaSym | Isolate | Chrysomelidae |
| 29 | 2998979428 | Enterobacteriaceae endosymbiont of Donacia fulgens DfulgSym | Isolate | Chrysomelidae |
| 30 | 2999134809 | Enterobacteriaceae endosymbiont of Donacia crassipes DcraSym | Isolate | Chrysomelidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 2998832060 | Enterobacteriaceae endosymbiont of Donacia proxima DproxSym | Isolate | Chrysomelidae |
| 36 | 2998834370 | Enterobacteriaceae endosymbiont of Plateumaris consimilis PconSym | Isolate | Chrysomelidae |
| 37 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_119280 | 3300042612 | Bacteria | 25556 |
| 2 | Ga0466732_373365 | 3300042656 | Unclassified | 5368 |
| 3 | Ga0466706_221625 | 3300042599 | Bacteria | 6303 |
| 4 | Ga0466716_246529 | 3300042605 | Bacteria | 1800 |
| 5 | Ga0466719_137724 | 3300042606 | Bacteria | 13199 |
| 6 | Ga0466698_033667 | 3300042610 | Unclassified | 1735 |
| 7 | Ga0466703_402680 | 3300042636 | Bacteria | 1645 |
| 8 | Ga0466704_120585 | 3300042643 | Bacteria | 8375 |
| 9 | Ga0466704_339143 | 3300042643 | Unclassified | 2975 |
| 10 | Ga0466708_041979 | 3300042652 | Bacteria | 25396 |
| 11 | Ga0466708_123960 | 3300042652 | Bacteria | 7964 |
| 12 | JGI24698J34947_10025142 | 3300002449 | Unclassified | 3171 |
| 13 | Ga0466690_153846 | 3300042590 | Bacteria | 7322 |
| 14 | Ga0466691_139149 | 3300042593 | Bacteria | 19243 |
| 15 | Ga0466699_148322 | 3300042597 | Bacteria | 1438 |
| 16 | Ga0466699_366351 | 3300042597 | Bacteria | 3388 |
| 17 | Ga0466715_434045 | 3300042616 | Bacteria | 1774 |
| 18 | Ga0466715_583260 | 3300042616 | Bacteria | 6367 |
| 19 | Ga0466723_059777 | 3300042618 | Bacteria | 1251 |
| 20 | Ga0466723_087992 | 3300042618 | Bacteria | 2570 |
| 21 | Ga0466729_171960 | 3300042621 | Bacteria | 2457 |
| 22 | Ga0466717_256172 | 3300042604 | Bacteria | 2243 |
| 23 | Ga0466716_147614 | 3300042605 | Bacteria | 1724 |
| 24 | Ga0466719_031558 | 3300042606 | Bacteria | 15956 |
| 25 | Ga0466719_085671 | 3300042606 | Bacteria | 7991 |
| 26 | Ga0466698_149650 | 3300042610 | Bacteria | 3559 |
| 27 | Ga0466704_204560 | 3300042643 | Bacteria | 25186 |
| 28 | Ga0466708_122099 | 3300042652 | Bacteria | 23996 |
| 29 | Ga0466708_289953 | 3300042652 | Bacteria | 37911 |
| 30 | Ga0466727_025890 | 3300042655 | Bacteria | 1406 |
| 31 | Ga0466693_347600 | 3300042592 | Bacteria | 1824 |
| 32 | Ga0466715_523090 | 3300042616 | Bacteria | 1500 |
| 33 | Ga0466723_109862 | 3300042618 | Bacteria | 5882 |
| 34 | Ga0466723_209124 | 3300042618 | Bacteria | 14259 |
| 35 | Ga0466728_389754 | 3300042620 | Bacteria | 2207 |
| 36 | Ga0466705_244815 | 3300042612 | Bacteria | 1246 |
| 37 | Ga0466703_071861 | 3300042636 | Bacteria | 17885 |
| 38 | Ga0466703_426546 | 3300042636 | Bacteria | 181657 |
| 39 | Ga0466704_046613 | 3300042643 | Bacteria | 6692 |
| 40 | Ga0466704_075061 | 3300042643 | Bacteria | 1536 |
| 41 | Ga0466690_321002 | 3300042590 | Bacteria | 2938 |
| 42 | Ga0466691_030166 | 3300042593 | Bacteria | 1813 |
| 43 | Ga0466696_171817 | 3300042596 | Bacteria | 1198 |
| 44 | Ga0466696_459653 | 3300042596 | Unclassified | 1030 |
| 45 | Ga0466723_058896 | 3300042618 | Bacteria | 1768 |
| 46 | Ga0466723_374157 | 3300042618 | Bacteria | 1311 |
| 47 | Ga0466728_080646 | 3300042620 | Bacteria | 15947 |
| 48 | Ga0466728_133534 | 3300042620 | Unclassified | 3135 |
| 49 | Ga0466705_248722 | 3300042612 | Bacteria | 12866 |
| 50 | Ga0466714_157821 | 3300042603 | Bacteria | 9563 |
| 51 | Ga0466717_152718 | 3300042604 | Bacteria | 1533 |
| 52 | Ga0466716_186211 | 3300042605 | Bacteria | 74115 |
| 53 | Ga0466729_249403 | 3300042621 | Bacteria | 4567 |
| 54 | Ga0466704_435940 | 3300042643 | Bacteria | 6236 |
| 55 | Ga0466709_000907 | 3300042648 | Bacteria | 2661 |
| 56 | Ga0466690_389228 | 3300042590 | Bacteria | 2570 |
| 57 | Ga0466691_049820 | 3300042593 | Unclassified | 6609 |
| 58 | Ga0466705_513464 | 3300042612 | Bacteria | 8104 |
| 59 | Ga0466711_129089 | 3300042615 | Bacteria | 9915 |
| 60 | Ga0466711_264630 | 3300042615 | Bacteria | 77963 |
| 61 | Ga0466723_009986 | 3300042618 | Bacteria | 61591 |
| 62 | Ga0466723_051861 | 3300042618 | Bacteria | 4354 |
| 63 | Ga0466723_064166 | 3300042618 | Bacteria | 12542 |
| 64 | Ga0466723_202914 | 3300042618 | Unclassified | 11504 |
| 65 | Ga0466705_137171 | 3300042612 | Unclassified | 1722 |
| 66 | Ga0466705_250964 | 3300042612 | Unclassified | 15856 |
| 67 | Ga0466707_225380 | 3300042601 | Bacteria | 15917 |
| 68 | Ga0466717_220100 | 3300042604 | Bacteria | 6683 |
| 69 | Ga0466716_010863 | 3300042605 | Bacteria | 9447 |
| 70 | Ga0466702_384993 | 3300042635 | Bacteria | 1240 |
| 71 | Ga0466703_381736 | 3300042636 | Bacteria | 1463 |
| 72 | Ga0466709_168259 | 3300042648 | Bacteria | 21657 |
| 73 | Ga0466708_331349 | 3300042652 | Unclassified | 1764 |
| 74 | Ga0466691_012294 | 3300042593 | Bacteria | 27486 |
| 75 | Ga0466691_115447 | 3300042593 | Unclassified | 3408 |
| 76 | Ga0466696_138004 | 3300042596 | Bacteria | 1343 |
| 77 | Ga0466715_020892 | 3300042616 | Bacteria | 8566 |
| 78 | Ga0466718_016984 | 3300042617 | Bacteria | 2599 |
| 79 | Ga0466723_073985 | 3300042618 | Bacteria | 19942 |
| 80 | Ga0466705_180606 | 3300042612 | Bacteria | 27935 |
| 81 | Ga0466705_263915 | 3300042612 | Bacteria | 7383 |
| 82 | Ga0466713_151116 | 3300042602 | Bacteria | 31590 |
| 83 | Ga0466719_447116 | 3300042606 | Bacteria | 10146 |
| 84 | Ga0466704_221868 | 3300042643 | Unclassified | 1724 |
| 85 | Ga0466691_121310 | 3300042593 | Bacteria | 9656 |
| 86 | Ga0466696_120991 | 3300042596 | Bacteria | 1035 |
| 87 | Ga0466711_483722 | 3300042615 | Bacteria | 3736 |
| 88 | Ga0466715_407881 | 3300042616 | Bacteria | 4737 |
| 89 | Ga0466715_622980 | 3300042616 | Bacteria | 273902 |
| 90 | Ga0466723_012867 | 3300042618 | Bacteria | 14605 |
| 91 | Ga0466723_073788 | 3300042618 | Bacteria | 30376 |
| 92 | Ga0466728_032614 | 3300042620 | Bacteria | 43976 |
| 93 | Ga0466728_372282 | 3300042620 | Bacteria | 14644 |
| 94 | Ga0466705_092890 | 3300042612 | Bacteria | 33744 |
| 95 | Ga0466716_257960 | 3300042605 | Bacteria | 1954 |
| 96 | Ga0466719_290602 | 3300042606 | Bacteria | 1588 |
| 97 | Ga0466703_101688 | 3300042636 | Bacteria | 41897 |
| 98 | Ga0466704_574534 | 3300042643 | Bacteria | 10168 |
| 99 | Ga0466709_395093 | 3300042648 | Bacteria | 9281 |
| 100 | Ga0466724_41334 | 3300042649 | Bacteria | 1730 |
| 101 | JGI24695J34938_10118490 | 3300002450 | Bacteria | 1078 |
| 102 | Ga0466690_277868 | 3300042590 | Bacteria | 4521 |
| 103 | Ga0466691_067559 | 3300042593 | Bacteria | 52286 |
| 104 | Ga0466712_076365 | 3300042614 | Bacteria | 1822 |
| 105 | Ga0466728_358046 | 3300042620 | Bacteria | 2402 |
| 106 | Ga0466728_425198 | 3300042620 | Bacteria | 51060 |
| 107 | Ga0466705_050927 | 3300042612 | Bacteria | 2000 |
| 108 | Ga0466705_267479 | 3300042612 | Bacteria | 101515 |
| 109 | Ga0466735_155877 | 3300042624 | Bacteria | 105020 |
| 110 | Ga0466708_161522 | 3300042652 | Bacteria | 5648 |
| 111 | Ga0264413_119903 | 3300024493 | Bacteria | 16289 |
| 112 | Ga0466696_142894 | 3300042596 | Bacteria | 1063 |
| 113 | Ga0466699_079552 | 3300042597 | Bacteria | 2293 |
| 114 | Ga0466715_319265 | 3300042616 | Bacteria | 21907 |
| 115 | Ga0466715_592842 | 3300042616 | Bacteria | 2719 |
| 116 | Ga0466723_173911 | 3300042618 | Bacteria | 6446 |
| 117 | Ga0466723_176490 | 3300042618 | Bacteria | 1678 |
| 118 | Ga0466723_370682 | 3300042618 | Bacteria | 6540 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.