Protein Family IF11918

Metagenome Isolate
118 Members
46 Samples
110 Scaffolds
214.04 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2819994798|2819995759|
Length
231 aa
Sequence
VAAAAFYFSGFCGIIRKMEIIPNFAVFEGLDGSGTTSQQTLLAEYLEKNNAPFFATAEPTAGPVGTLLRQALKKNISLAPQTMARLFAADRCEHLYGKDGIAERSAKGQLVVCDRYVLSSLVYQGIECGDELPAALNADFPAPHLLVYLDIDPALAQQRLKSRQTLEIYEYPEFQAKVREKYLSLLDRFRQAGVEVAVIDAAKSPKEVFEQVLGAFAKMPIFKDMKMEKAR

📊 Sample Types

Isolate 6.8%
Metagenome 93.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.7%
Kalotermitidae 20.5%
Unclassified 20.5%
Termopsidae 6.8%
Rhinotermitidae 4.5%

🌳 Taxonomy

Archaea 0
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
6 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
7 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
8 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
9 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
10 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
11 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
14 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
15 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
16 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
17 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
18 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
19 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
20 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
21 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
22 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
23 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
31 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
34 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
35 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
36 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
37 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_021051 3300042656 Bacteria 5598
2 Ga0466700_066919 3300042600 Unclassified 1792
3 Ga0466720_135734 3300042607 Bacteria 10226
4 Ga0466690_237296 3300042590 Bacteria 1108
5 Ga0466699_144876 3300042597 Bacteria 4826
6 JGI24698J34947_10120374 3300002449 Bacteria 1140
7 JGI24695J34938_10066555 3300002450 Bacteria 1518
8 JGI24699J35502_11113918 3300002509 Bacteria 2835
9 Ga0072941_1121025 3300005201 Bacteria 7084
10 Ga0466735_062315 3300042624 Bacteria 8963
11 Ga0466703_214579 3300042636 Bacteria 27555
12 Ga0466704_218768 3300042643 Bacteria 93221
13 Ga0466720_089210 3300042607 Bacteria 18028
14 Ga0466722_176492 3300042609 Bacteria 1618
15 Ga0264413_119852 3300024493 Bacteria 10004
16 Ga0264413_125221 3300024493 Bacteria 11706
17 Ga0466690_042259 3300042590 Bacteria 3063
18 Ga0466690_350377 3300042590 Bacteria 16475
19 Ga0466692_006658 3300042591 Bacteria 5699
20 Ga0466692_015697 3300042591 Bacteria 1845
21 Ga0466694_015656 3300042594 Bacteria 26194
22 Ga0466699_149007 3300042597 Bacteria 4634
23 Ga0466699_316400 3300042597 Bacteria 7546
24 Ga0123353_10166674 3300010167 Bacteria 3501
25 Ga0466712_055037 3300042614 Bacteria 12103
26 Ga0466718_011466 3300042617 Bacteria 3967
27 Ga0466723_047750 3300042618 Bacteria 8066
28 Ga0466728_078303 3300042620 Bacteria 7175
29 JGI24700J35501_10928559 3300002508 Bacteria 7798
30 Ga0072940_1019437 3300005200 Bacteria 3843
31 Ga0466719_044536 3300042606 Bacteria 15513
32 Ga0466720_027933 3300042607 Bacteria 34844
33 Ga0466722_129064 3300042609 Bacteria 2299
34 Ga0264413_120312 3300024493 Bacteria 10757
35 Ga0264413_127319 3300024493 Bacteria 1062
36 Ga0466690_101025 3300042590 Bacteria 1354
37 Ga0466693_056170 3300042592 Bacteria 10629
38 Ga0466699_159778 3300042597 Bacteria 14855
39 Ga0466699_294829 3300042597 Bacteria 18693
40 Ga0466699_362229 3300042597 Bacteria 1150
41 JGI24698J34947_10002494 3300002449 Bacteria 9933
42 JGI24698J34947_10002969 3300002449 Bacteria 9191
43 JGI24698J34947_10004859 3300002449 Bacteria 7359
44 JGI24698J34947_10062983 3300002449 Bacteria 1819
45 JGI24698J34947_10102996 3300002449 Bacteria 1278
46 JGI24695J34938_10024526 3300002450 Bacteria 2895
47 Ga0072940_1021629 3300005200 Bacteria 12883
48 Ga0072941_1035382 3300005201 Bacteria 10071
49 Ga0466699_001476 3300042597 Bacteria 19710
50 Ga0466699_312427 3300042597 Bacteria 3958
51 Ga0466699_341864 3300042597 Bacteria 1082
52 Ga0123354_10208830 3300010882 Unclassified 2118
53 AustNasuHG_c1000711 3300000089 Bacteria 11827
54 AustNasuHG_c1005740 3300000089 Bacteria 4435
55 JGI24695J34938_10045009 3300002450 Unclassified 1960
56 Ga0072940_1024945 3300005200 Bacteria 4669
57 Ga0072941_1000713 3300005201 Bacteria 13113
58 Ga0466734_172301 3300042623 Bacteria 1599
59 Ga0466720_088136 3300042607 Bacteria 15980
60 Ga0466720_222315 3300042607 Bacteria 38494
61 Ga0466722_004699 3300042609 Bacteria 1515
62 Ga0264413_102291 3300024493 Bacteria 14873
63 Ga0264413_116756 3300024493 Bacteria 1857
64 Ga0466691_178757 3300042593 Bacteria 1978
65 Ga0466699_001160 3300042597 Bacteria 10346
66 Ga0466699_249100 3300042597 Bacteria 11668
67 Ga0466712_091130 3300042614 Bacteria 23740
68 Ga0072941_1019837 3300005201 Bacteria 10373
69 Ga0466727_005630 3300042655 Bacteria 1891
70 Ga0466732_152019 3300042656 Bacteria 13014
71 Ga0466707_060287 3300042601 Bacteria 3675
72 Ga0466719_511187 3300042606 Bacteria 2770
73 Ga0466720_093021 3300042607 Bacteria 4723
74 Ga0466720_107771 3300042607 Bacteria 24087
75 Ga0466698_328612 3300042610 Bacteria 1112
76 Ga0264413_143793 3300024493 Bacteria 1658
77 Ga0466690_170668 3300042590 Bacteria 1704
78 Ga0466694_039022 3300042594 Bacteria 2416
79 Ga0466694_154331 3300042594 Bacteria 3077
80 Ga0466696_287078 3300042596 Bacteria 3465
81 Ga0123355_10088956 3300009826 Bacteria 4902
82 Ga0123355_10193102 3300009826 Bacteria 2993
83 Ga0466712_130141 3300042614 Bacteria 11920
84 Ga0466712_227559 3300042614 Bacteria 24106
85 Ga0466723_147861 3300042618 Bacteria 4180
86 Ga0466723_297263 3300042618 Bacteria 29498
87 JGI24698J34947_10023735 3300002449 Bacteria 3280
88 Ga0466700_221794 3300042600 Bacteria 1604
89 Ga0466722_147725 3300042609 Bacteria 6876
90 Ga0466691_082415 3300042593 Bacteria 25944
91 Ga0466694_283593 3300042594 Bacteria 1590
92 Ga0466699_084875 3300042597 Bacteria 1754
93 Ga0466699_166378 3300042597 Bacteria 7559
94 Ga0123356_10005618 3300010049 Bacteria 12745
95 Ga0466712_083953 3300042614 Bacteria 1362
96 Ga0466718_031409 3300042617 Bacteria 1727
97 Ga0466718_042889 3300042617 Unclassified 5932
98 JGI24698J34947_10023009 3300002449 Bacteria 3336
99 Ga0072941_1048790 3300005201 Bacteria 10733
100 Ga0466696_034295 3300042596 Bacteria 17146
101 Ga0466699_009139 3300042597 Bacteria 17874
102 Ga0466699_239217 3300042597 Bacteria 2316
103 Ga0123353_10175438 3300010167 Bacteria 3398
104 Ga0123353_10728542 3300010167 Bacteria 1385
105 Ga0466715_225624 3300042616 Bacteria 2630
106 Ga0466726_086381 3300042619 Bacteria 3935
107 JGI24698J34947_10040949 3300002449 Bacteria 2389
108 Ga0072941_1011114 3300005201 Bacteria 12795
109 Ga0072941_1048074 3300005201 Bacteria 12385
110 Ga0466731_258276 3300042622 Bacteria 5062

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042600 Ga0466700_066919 Ga0466700_066919_1202_1768 188
2 iso_pr_bacteria 2781125664 2781339333 191
3 3300010167 Ga0123353_10728542 Ga0123353_107285421 198
4 3300042592 Ga0466693_056170 Ga0466693_056170_6124_6762 202
5 3300002450 JGI24695J34938_10045009 JGI24695J34938_100450092 203
6 3300042593 Ga0466691_082415 Ga0466691_082415_14670_15290 206
7 3300024493 Ga0264413_143793 Ga0264413_1437933 207
8 3300002450 JGI24695J34938_10024526 JGI24695J34938_100245262 208
9 3300024493 Ga0264413_102291 Ga0264413_1022912 208
10 3300042591 Ga0466692_015697 Ga0466692_015697_1132_1758 208
11 3300042594 Ga0466694_039022 Ga0466694_039022_530_1156 208
12 3300042601 Ga0466707_060287 Ga0466707_060287_2850_3476 208
13 3300042606 Ga0466719_044536 Ga0466719_044536_10634_11260 208
14 3300042607 Ga0466720_027933 Ga0466720_027933_18737_19363 208
15 3300042607 Ga0466720_107771 Ga0466720_107771_1663_2289 208
16 3300042614 Ga0466712_091130 Ga0466712_091130_3331_3957 208
17 3300042617 Ga0466718_042889 Ga0466718_042889_3549_4175 208
18 3300042622 Ga0466731_258276 Ga0466731_258276_3626_4252 208
19 3300042643 Ga0466704_218768 Ga0466704_218768_81488_82114 208
20 iso_pr_bacteria 2781125692 2781430427 208
21 3300042590 Ga0466690_350377 Ga0466690_350377_3249_3878 209
22 3300042607 Ga0466720_089210 Ga0466720_089210_12207_12836 209
23 3300042607 Ga0466720_093021 Ga0466720_093021_861_1490 209
24 3300042609 Ga0466722_176492 Ga0466722_176492_205_834 209
25 3300042614 Ga0466712_055037 Ga0466712_055037_10244_10873 209
26 3300042614 Ga0466712_130141 Ga0466712_130141_10722_11351 209
27 3300042656 Ga0466732_021051 Ga0466732_021051_3034_3663 209
28 iso_pr_bacteria 2781125658 2781326085 209
29 3300002449 JGI24698J34947_10023735 JGI24698J34947_100237352 210
30 3300002449 JGI24698J34947_10102996 JGI24698J34947_101029962 210
31 3300002449 JGI24698J34947_10120374 JGI24698J34947_101203742 210
32 3300010049 Ga0123356_10005618 Ga0123356_100056185 210
33 3300010167 Ga0123353_10166674 Ga0123353_101666742 210
34 3300010167 Ga0123353_10175438 Ga0123353_101754382 210
35 3300010882 Ga0123354_10208830 Ga0123354_102088302 210
36 3300024493 Ga0264413_119852 Ga0264413_1198524 210
37 3300024493 Ga0264413_125221 Ga0264413_1252213 210
38 3300042594 Ga0466694_154331 Ga0466694_154331_2120_2752 210
39 3300042597 Ga0466699_001476 Ga0466699_001476_15428_16060 210
40 3300042597 Ga0466699_009139 Ga0466699_009139_15841_16473 210
41 3300042597 Ga0466699_144876 Ga0466699_144876_269_901 210
42 3300042607 Ga0466720_088136 Ga0466720_088136_9819_10451 210
43 3300042607 Ga0466720_135734 Ga0466720_135734_299_931 210
44 3300042610 Ga0466698_328612 Ga0466698_328612_109_741 210
45 3300042623 Ga0466734_172301 Ga0466734_172301_56_688 210
46 3300042624 Ga0466735_062315 Ga0466735_062315_2667_3299 210
47 3300042655 Ga0466727_005630 Ga0466727_005630_481_1113 210
48 iso_pr_bacteria 2781125694 2781436378 210
49 3300000089 AustNasuHG_c1005740 AustNasuHG_10057404 211
50 3300005201 Ga0072941_1048790 Ga0072941_10487907 211
51 3300005201 Ga0072941_1121025 Ga0072941_11210254 211
52 3300042597 Ga0466699_239217 Ga0466699_239217_1429_2064 211
53 3300042609 Ga0466722_147725 Ga0466722_147725_5535_6170 211
54 3300042614 Ga0466712_083953 Ga0466712_083953_302_937 211
55 3300000089 AustNasuHG_c1000711 AustNasuHG_10007115 212
56 3300005200 Ga0072940_1024945 Ga0072940_10249453 212
57 3300005201 Ga0072941_1048074 Ga0072941_10480745 212
58 3300024493 Ga0264413_116756 Ga0264413_1167563 212
59 3300024493 Ga0264413_127319 Ga0264413_1273191 212
60 3300042590 Ga0466690_042259 Ga0466690_042259_1647_2285 212
61 3300042590 Ga0466690_237296 Ga0466690_237296_67_705 212
62 3300042607 Ga0466720_222315 Ga0466720_222315_15701_16339 212
63 3300042617 Ga0466718_011466 Ga0466718_011466_2669_3307 212
64 3300042617 Ga0466718_031409 Ga0466718_031409_72_710 212
65 iso_pr_bacteria 2781125689 2781424960 212
66 3300002449 JGI24698J34947_10002494 JGI24698J34947_100024944 213
67 3300002449 JGI24698J34947_10002969 JGI24698J34947_100029695 213
68 3300005200 Ga0072940_1019437 Ga0072940_10194376 213
69 3300005200 Ga0072940_1021629 Ga0072940_10216291 213
70 3300005201 Ga0072941_1011114 Ga0072941_10111147 213
71 3300005201 Ga0072941_1019837 Ga0072941_10198376 213
72 3300042590 Ga0466690_170668 Ga0466690_170668_470_1111 213
73 3300042596 Ga0466696_287078 Ga0466696_287078_703_1344 213
74 3300002449 JGI24698J34947_10040949 JGI24698J34947_100409493 214
75 3300005201 Ga0072941_1035382 Ga0072941_10353822 214
76 3300042590 Ga0466690_101025 Ga0466690_101025_137_781 214
77 3300042593 Ga0466691_178757 Ga0466691_178757_496_1140 214
78 3300042597 Ga0466699_001160 Ga0466699_001160_8943_9587 214
79 3300042597 Ga0466699_159778 Ga0466699_159778_11137_11781 214
80 3300042597 Ga0466699_249100 Ga0466699_249100_917_1561 214
81 3300042597 Ga0466699_362229 Ga0466699_362229_343_987 214
82 3300042618 Ga0466723_147861 Ga0466723_147861_2070_2714 214
83 iso_pr_bacteria 2781125682 2781408425 214
84 3300002508 JGI24700J35501_10928559 JGI24700J35501_109285591 215
85 3300042597 Ga0466699_294829 Ga0466699_294829_2832_3479 215
86 3300042620 Ga0466728_078303 Ga0466728_078303_1033_1680 215
87 3300009826 Ga0123355_10088956 Ga0123355_100889562 216
88 3300042597 Ga0466699_341864 Ga0466699_341864_338_988 216
89 3300042606 Ga0466719_511187 Ga0466719_511187_544_1194 216
90 iso_pr_bacteria 2781125683 2781410863 216
91 3300002449 JGI24698J34947_10062983 JGI24698J34947_100629832 217
92 3300009826 Ga0123355_10193102 Ga0123355_101931025 217
93 3300042614 Ga0466712_227559 Ga0466712_227559_823_1476 217
94 3300042618 Ga0466723_047750 Ga0466723_047750_6392_7045 217
95 3300002449 JGI24698J34947_10004859 JGI24698J34947_100048594 218
96 3300002450 JGI24695J34938_10066555 JGI24695J34938_100665552 219
97 3300042597 Ga0466699_149007 Ga0466699_149007_2448_3107 219
98 3300042616 Ga0466715_225624 Ga0466715_225624_1170_1829 219
99 3300042609 Ga0466722_004699 Ga0466722_004699_838_1500 220
100 3300042597 Ga0466699_084875 Ga0466699_084875_838_1503 221
101 3300042600 Ga0466700_221794 Ga0466700_221794_856_1521 221
102 3300024493 Ga0264413_120312 Ga0264413_1203124 223
103 3300042594 Ga0466694_015656 Ga0466694_015656_11765_12436 223
104 3300042596 Ga0466696_034295 Ga0466696_034295_3636_4310 224
105 3300042618 Ga0466723_297263 Ga0466723_297263_11680_12354 224
106 3300002449 JGI24698J34947_10023009 JGI24698J34947_100230092 225
107 3300002509 JGI24699J35502_11113918 JGI24699J35502_111139182 226
108 3300042619 Ga0466726_086381 Ga0466726_086381_633_1313 226
109 3300042594 Ga0466694_283593 Ga0466694_283593_735_1418 227
110 3300042597 Ga0466699_312427 Ga0466699_312427_3201_3884 227
111 3300005201 Ga0072941_1000713 Ga0072941_10007137 228
112 3300042656 Ga0466732_152019 Ga0466732_152019_11483_12172 229
113 3300042636 Ga0466703_214579 Ga0466703_214579_19342_20037 231
114 iso_pr_bacteria 2819994798 2819995759 231
115 3300042609 Ga0466722_129064 Ga0466722_129064_262_963 233
116 3300042591 Ga0466692_006658 Ga0466692_006658_2377_3084 235
117 3300042597 Ga0466699_166378 Ga0466699_166378_6693_7472 259
118 3300042597 Ga0466699_316400 Ga0466699_316400_6693_7472 259

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02223 Thymidylate_kin Thymidylate kinase 27 211 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.