Protein Family IF11832
Metagenome
Isolate
134
Members
47
Samples
129
Scaffolds
214.67
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125687|2781421084|
- Length
- 234 aa
- Sequence
- MSGINFLLVLKEVFPLLMRGIVITVETAFFALVIALILGLLTCLMGMSKFFILKLIAKGYIWIIRGTPLLVQTFFIYFGIPQLIQSLGFDFRLTPLVAGIITLSLNAGAYIAEIFRGGIQAIDHGQMEAARSLGLSHYRAMFRIILPQAVRISIPSLVNQFIISLKDTSIISIISLADIVYQAKIYIGRTMQSFATWTVVGLFYLAIITVLSRISTHVEKRLDYGQKSRRQGSV
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.3%
Kalotermitidae
30.4%
Unclassified
13.0%
Rhinotermitidae
6.5%
Termopsidae
6.5%
Vespidae
2.2%
Taxonomy
Archaea
0
Bacteria
122
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 13 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 28 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 39 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 43 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 44 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_106053 | 3300042656 | Bacteria | 6602 |
| 2 | Ga0466709_277474 | 3300042648 | Bacteria | 1814 |
| 3 | Ga0466708_324635 | 3300042652 | Bacteria | 4016 |
| 4 | Ga0466727_150583 | 3300042655 | Bacteria | 1098 |
| 5 | Ga0466690_162455 | 3300042590 | Bacteria | 1299 |
| 6 | Ga0466692_146780 | 3300042591 | Bacteria | 1309 |
| 7 | Ga0466699_169003 | 3300042597 | Bacteria | 3120 |
| 8 | Ga0466716_113775 | 3300042605 | Bacteria | 3473 |
| 9 | JGI24698J34947_10000834 | 3300002449 | Bacteria | 15444 |
| 10 | JGI24698J34947_10024811 | 3300002449 | Bacteria | 3197 |
| 11 | JGI24702J35022_10014065 | 3300002462 | Bacteria | 4422 |
| 12 | Ga0072940_1104522 | 3300005200 | Unclassified | 1530 |
| 13 | Ga0072941_1037595 | 3300005201 | Bacteria | 1123 |
| 14 | Ga0466711_194758 | 3300042615 | Bacteria | 6929 |
| 15 | Ga0466723_201025 | 3300042618 | Bacteria | 5206 |
| 16 | Ga0123357_10120307 | 3300009784 | Bacteria | 3310 |
| 17 | Ga0123356_10194841 | 3300010049 | Bacteria | 2061 |
| 18 | Ga0466735_167561 | 3300042624 | Bacteria | 2276 |
| 19 | Ga0466703_375091 | 3300042636 | Bacteria | 9203 |
| 20 | Ga0466690_271758 | 3300042590 | Bacteria | 1991 |
| 21 | Ga0466691_099650 | 3300042593 | Bacteria | 2845 |
| 22 | Ga0466695_231594 | 3300042595 | Bacteria | 3689 |
| 23 | Ga0466716_495923 | 3300042605 | Bacteria | 1644 |
| 24 | Ga0466720_152124 | 3300042607 | Bacteria | 6725 |
| 25 | Ga0466722_097367 | 3300042609 | Bacteria | 7864 |
| 26 | Ga0466698_464700 | 3300042610 | Bacteria | 1614 |
| 27 | Ga0466705_505663 | 3300042612 | Bacteria | 1302 |
| 28 | Ga0466715_214202 | 3300042616 | Bacteria | 2742 |
| 29 | Ga0466715_507184 | 3300042616 | Bacteria | 2742 |
| 30 | Ga0466726_272266 | 3300042619 | Bacteria | 2907 |
| 31 | Ga0466726_298654 | 3300042619 | Bacteria | 23143 |
| 32 | Ga0123356_10048380 | 3300010049 | Bacteria | 3958 |
| 33 | Ga0123354_10045288 | 3300010882 | Bacteria | 6733 |
| 34 | Ga0466735_138803 | 3300042624 | Bacteria | 1070 |
| 35 | Ga0466708_187928 | 3300042652 | Bacteria | 3163 |
| 36 | Ga0456237_0005138 | 3300041968 | Bacteria | 2082 |
| 37 | Ga0466690_048700 | 3300042590 | Bacteria | 4334 |
| 38 | Ga0466690_205210 | 3300042590 | Unclassified | 2007 |
| 39 | Ga0466696_187005 | 3300042596 | Bacteria | 3705 |
| 40 | Ga0466719_109212 | 3300042606 | Bacteria | 39694 |
| 41 | Ga0466720_086003 | 3300042607 | Bacteria | 18891 |
| 42 | Ga0466720_125179 | 3300042607 | Bacteria | 9567 |
| 43 | Ga0466722_184590 | 3300042609 | Bacteria | 7470 |
| 44 | Ga0466715_075201 | 3300042616 | Bacteria | 8786 |
| 45 | Ga0466723_265159 | 3300042618 | Bacteria | 7155 |
| 46 | Ga0466723_285375 | 3300042618 | Bacteria | 5855 |
| 47 | Ga0123353_10014851 | 3300010167 | Bacteria | 11262 |
| 48 | Ga0466692_139545 | 3300042591 | Unclassified | 1413 |
| 49 | Ga0466691_049468 | 3300042593 | Bacteria | 7069 |
| 50 | Ga0466696_293004 | 3300042596 | Bacteria | 1115 |
| 51 | Ga0466707_386740 | 3300042601 | Bacteria | 1455 |
| 52 | Ga0466713_102360 | 3300042602 | Bacteria | 6258 |
| 53 | Ga0466722_149496 | 3300042609 | Bacteria | 7606 |
| 54 | Ga0466698_357558 | 3300042610 | Bacteria | 1799 |
| 55 | JGI24698J34947_10041941 | 3300002449 | Unclassified | 2354 |
| 56 | JGI24695J34938_10007561 | 3300002450 | Bacteria | 6338 |
| 57 | Ga0072940_1000261 | 3300005200 | Bacteria | 18421 |
| 58 | Ga0466711_188545 | 3300042615 | Bacteria | 5230 |
| 59 | Ga0466718_169926 | 3300042617 | Bacteria | 1709 |
| 60 | Ga0123353_12199597 | 3300010167 | Bacteria | 667 |
| 61 | Ga0123354_10089333 | 3300010882 | Bacteria | 4277 |
| 62 | Ga0466704_335145 | 3300042643 | Unclassified | 5318 |
| 63 | Ga0466709_145734 | 3300042648 | Unclassified | 4224 |
| 64 | Ga0466708_028394 | 3300042652 | Bacteria | 2052 |
| 65 | Ga0466727_285390 | 3300042655 | Unclassified | 3149 |
| 66 | Ga0466690_022407 | 3300042590 | Bacteria | 7442 |
| 67 | Ga0466692_191856 | 3300042591 | Bacteria | 2301 |
| 68 | Ga0466694_138110 | 3300042594 | Bacteria | 15002 |
| 69 | Ga0466699_135771 | 3300042597 | Bacteria | 1024 |
| 70 | Ga0466699_142849 | 3300042597 | Bacteria | 4479 |
| 71 | Ga0466699_191850 | 3300042597 | Bacteria | 3294 |
| 72 | Ga0466716_183887 | 3300042605 | Bacteria | 9848 |
| 73 | Ga0466719_061304 | 3300042606 | Bacteria | 5649 |
| 74 | Ga0466698_053651 | 3300042610 | Bacteria | 2007 |
| 75 | JGI24698J34947_10012765 | 3300002449 | Bacteria | 4598 |
| 76 | Ga0072941_1033586 | 3300005201 | Bacteria | 1404 |
| 77 | Ga0466711_143015 | 3300042615 | Unclassified | 1103 |
| 78 | Ga0466715_021018 | 3300042616 | Bacteria | 3036 |
| 79 | Ga0466715_024097 | 3300042616 | Bacteria | 6234 |
| 80 | Ga0466715_363053 | 3300042616 | Bacteria | 2294 |
| 81 | Ga0466715_524513 | 3300042616 | Unclassified | 1404 |
| 82 | Ga0466723_128858 | 3300042618 | Bacteria | 4381 |
| 83 | Ga0466726_471976 | 3300042619 | Bacteria | 5114 |
| 84 | Ga0466726_480471 | 3300042619 | Bacteria | 4001 |
| 85 | Ga0466732_100504 | 3300042656 | Bacteria | 7132 |
| 86 | Ga0466735_068343 | 3300042624 | Bacteria | 2885 |
| 87 | Ga0466703_041606 | 3300042636 | Bacteria | 6969 |
| 88 | Ga0466708_448868 | 3300042652 | Bacteria | 4611 |
| 89 | Ga0466690_350310 | 3300042590 | Bacteria | 8229 |
| 90 | Ga0466691_166631 | 3300042593 | Bacteria | 5457 |
| 91 | Ga0466691_222280 | 3300042593 | Bacteria | 2305 |
| 92 | Ga0466694_171902 | 3300042594 | Bacteria | 3214 |
| 93 | Ga0466717_284794 | 3300042604 | Bacteria | 2186 |
| 94 | Ga0466719_329468 | 3300042606 | Bacteria | 2202 |
| 95 | JGI24698J34947_10070575 | 3300002449 | Bacteria | 1681 |
| 96 | Ga0072941_1015932 | 3300005201 | Bacteria | 4618 |
| 97 | Ga0466705_416874 | 3300042612 | Bacteria | 7589 |
| 98 | Ga0466711_056912 | 3300042615 | Bacteria | 17479 |
| 99 | Ga0466715_010693 | 3300042616 | Bacteria | 1440 |
| 100 | Ga0466728_137381 | 3300042620 | Bacteria | 2559 |
| 101 | Ga0466735_021124 | 3300042624 | Bacteria | 2110 |
| 102 | Ga0466709_129731 | 3300042648 | Bacteria | 2696 |
| 103 | Ga0466709_264685 | 3300042648 | Unclassified | 1403 |
| 104 | Ga0466690_404706 | 3300042590 | Unclassified | 1783 |
| 105 | Ga0466696_389271 | 3300042596 | Bacteria | 12485 |
| 106 | Ga0466699_186602 | 3300042597 | Bacteria | 3388 |
| 107 | Ga0466720_042141 | 3300042607 | Bacteria | 3528 |
| 108 | Ga0466722_069109 | 3300042609 | Bacteria | 31526 |
| 109 | JGI24698J34947_10004140 | 3300002449 | Bacteria | 7869 |
| 110 | Ga0466711_237720 | 3300042615 | Unclassified | 1434 |
| 111 | Ga0466715_405755 | 3300042616 | Bacteria | 13194 |
| 112 | Ga0466728_240567 | 3300042620 | Bacteria | 4036 |
| 113 | Ga0123357_10070837 | 3300009784 | Bacteria | 4626 |
| 114 | Ga0466702_236957 | 3300042635 | Bacteria | 1689 |
| 115 | Ga0466709_223126 | 3300042648 | Bacteria | 5796 |
| 116 | Ga0466708_274857 | 3300042652 | Bacteria | 29137 |
| 117 | Ga0466692_128374 | 3300042591 | Bacteria | 5282 |
| 118 | Ga0466696_022567 | 3300042596 | Bacteria | 14413 |
| 119 | Ga0466696_314652 | 3300042596 | Bacteria | 1436 |
| 120 | Ga0466707_028559 | 3300042601 | Bacteria | 1756 |
| 121 | Ga0466714_013378 | 3300042603 | Bacteria | 2128 |
| 122 | Ga0466712_105973 | 3300042614 | Bacteria | 3579 |
| 123 | Ga0466712_155652 | 3300042614 | Bacteria | 8823 |
| 124 | Ga0466712_209698 | 3300042614 | Bacteria | 1048 |
| 125 | Ga0466711_226610 | 3300042615 | Bacteria | 2976 |
| 126 | Ga0466711_317196 | 3300042615 | Bacteria | 22629 |
| 127 | Ga0466718_140986 | 3300042617 | Bacteria | 3936 |
| 128 | Ga0466723_204183 | 3300042618 | Bacteria | 1838 |
| 129 | Ga0466723_365771 | 3300042618 | Bacteria | 3591 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 41 | 223 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.