Protein Family IF11815
Metagenome
Isolate
111
Members
42
Samples
106
Scaffolds
371.25
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125682|2781408803|
- Length
- 406 aa
- Sequence
- MVGLLIVFGGYIPRCLRWGMLIELTIGKGDIPVIDADKAGPVSQRMARSVMGFYRPEEVRWHYEHGLVLQSIFLLGQRTGRGDFCDYVKSMYDTKITPTGEILTYRENEFNLDQVNPGKVLFQLYEKYGDEKYRVAIETLRDQLRQHPRTKAGGFWHKKIYPWQMWLDGLYMQGPFYAQYAALYGDAAKDFDDIVLQFTLVESKARDERTGLLYHAWDEAVWQKWANPATGCSPHFWGRAMGWYCMALMDTLDFTPPDSREGLVAIARRLLAPLLEYQDSQTGLWFQVLDRGYDAGNYTESSASSMFAYFLFKMLRLDLVPWNDAERVGAAADKAYRGLLEHKLRENHDGILSLTDICKVAGLGGTPYRDGSYEYYVAEPVAVDDFKGVGPFILASMEAESRAGQS
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.5%
Kalotermitidae
32.5%
Unclassified
12.5%
Termopsidae
7.5%
Rhinotermitidae
5.0%
Taxonomy
Archaea
0
Bacteria
110
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 2 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 21 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 32 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_029690 | 3300042656 | Bacteria | 1242 |
| 2 | Ga0466733_208167 | 3300042659 | Bacteria | 31218 |
| 3 | Ga0466707_165889 | 3300042601 | Bacteria | 1216 |
| 4 | Ga0466718_016240 | 3300042617 | Bacteria | 3701 |
| 5 | JGI24695J34938_10017992 | 3300002450 | Bacteria | 3548 |
| 6 | Ga0072941_1013574 | 3300005201 | Bacteria | 9271 |
| 7 | Ga0072941_1078876 | 3300005201 | Bacteria | 2115 |
| 8 | Ga0466696_043639 | 3300042596 | Bacteria | 4302 |
| 9 | Ga0466704_095845 | 3300042643 | Bacteria | 89284 |
| 10 | Ga0466709_178541 | 3300042648 | Bacteria | 10415 |
| 11 | Ga0466705_001436 | 3300042612 | Bacteria | 17855 |
| 12 | Ga0466705_086011 | 3300042612 | Bacteria | 10166 |
| 13 | Ga0466716_318956 | 3300042605 | Bacteria | 15933 |
| 14 | Ga0466712_171287 | 3300042614 | Bacteria | 21174 |
| 15 | Ga0466715_362926 | 3300042616 | Bacteria | 3090 |
| 16 | Ga0466723_208635 | 3300042618 | Bacteria | 2971 |
| 17 | Ga0466723_346041 | 3300042618 | Bacteria | 14390 |
| 18 | Ga0466726_365637 | 3300042619 | Bacteria | 2719 |
| 19 | JGI24698J34947_10048424 | 3300002449 | Bacteria | 2153 |
| 20 | JGI24695J34938_10001369 | 3300002450 | Bacteria | 20951 |
| 21 | Ga0415639_010394 | 3300038395 | Bacteria | 11605 |
| 22 | Ga0466690_174580 | 3300042590 | Bacteria | 2286 |
| 23 | Ga0466690_214071 | 3300042590 | Bacteria | 16418 |
| 24 | Ga0466692_143855 | 3300042591 | Bacteria | 4958 |
| 25 | Ga0466735_200047 | 3300042624 | Bacteria | 3902 |
| 26 | Ga0466703_304170 | 3300042636 | Bacteria | 7588 |
| 27 | Ga0466720_045416 | 3300042607 | Bacteria | 14390 |
| 28 | Ga0466720_081487 | 3300042607 | Bacteria | 31706 |
| 29 | Ga0466718_116758 | 3300042617 | Bacteria | 14641 |
| 30 | Ga0072941_1240259 | 3300005201 | Bacteria | 2434 |
| 31 | Ga0415639_184642 | 3300038395 | Bacteria | 2307 |
| 32 | Ga0466693_379272 | 3300042592 | Bacteria | 19669 |
| 33 | Ga0466735_087115 | 3300042624 | Bacteria | 4912 |
| 34 | Ga0466704_510523 | 3300042643 | Bacteria | 3368 |
| 35 | Ga0466709_179084 | 3300042648 | Bacteria | 4387 |
| 36 | Ga0466714_090828 | 3300042603 | Bacteria | 4998 |
| 37 | Ga0466722_266365 | 3300042609 | Bacteria | 11236 |
| 38 | Ga0123356_10305777 | 3300010049 | Bacteria | 1697 |
| 39 | Ga0466728_418472 | 3300042620 | Bacteria | 9456 |
| 40 | Ga0074263_104761 | 3300005485 | Bacteria | 8480 |
| 41 | Ga0466694_244312 | 3300042594 | Bacteria | 37974 |
| 42 | Ga0466705_222187 | 3300042612 | Bacteria | 16736 |
| 43 | Ga0466714_101842 | 3300042603 | Bacteria | 80008 |
| 44 | Ga0466716_238710 | 3300042605 | Bacteria | 8964 |
| 45 | Ga0466720_018543 | 3300042607 | Bacteria | 131979 |
| 46 | Ga0466720_096093 | 3300042607 | Bacteria | 3497 |
| 47 | Ga0466720_102189 | 3300042607 | Bacteria | 2172 |
| 48 | Ga0466722_063621 | 3300042609 | Bacteria | 6435 |
| 49 | Ga0466722_166522 | 3300042609 | Bacteria | 7319 |
| 50 | Ga0466715_494209 | 3300042616 | Bacteria | 17849 |
| 51 | Ga0466718_097298 | 3300042617 | Bacteria | 24857 |
| 52 | Ga0466718_168964 | 3300042617 | Bacteria | 6403 |
| 53 | Ga0466690_390620 | 3300042590 | Bacteria | 26148 |
| 54 | Ga0466708_031664 | 3300042652 | Bacteria | 5112 |
| 55 | Ga0466708_177031 | 3300042652 | Bacteria | 25545 |
| 56 | Ga0466720_084737 | 3300042607 | Bacteria | 18029 |
| 57 | Ga0466722_182467 | 3300042609 | Bacteria | 5498 |
| 58 | Ga0466698_270191 | 3300042610 | Bacteria | 1889 |
| 59 | Ga0123356_10000407 | 3300010049 | Bacteria | 48938 |
| 60 | Ga0466728_054735 | 3300042620 | Bacteria | 7500 |
| 61 | Ga0466728_379950 | 3300042620 | Bacteria | 4683 |
| 62 | JGI24698J34947_10015593 | 3300002449 | Bacteria | 4137 |
| 63 | JGI24698J34947_10026840 | 3300002449 | Bacteria | 3058 |
| 64 | JGI24698J34947_10047554 | 3300002449 | Bacteria | 2177 |
| 65 | Ga0072941_1021846 | 3300005201 | Bacteria | 9925 |
| 66 | Ga0466691_043739 | 3300042593 | Bacteria | 24323 |
| 67 | Ga0466703_191810 | 3300042636 | Bacteria | 6920 |
| 68 | Ga0466704_119498 | 3300042643 | Bacteria | 6175 |
| 69 | Ga0466705_076813 | 3300042612 | Bacteria | 18968 |
| 70 | Ga0466707_162172 | 3300042601 | Bacteria | 2993 |
| 71 | Ga0466707_367932 | 3300042601 | Bacteria | 1728 |
| 72 | Ga0466722_025779 | 3300042609 | Bacteria | 1285 |
| 73 | Ga0466722_175671 | 3300042609 | Bacteria | 2850 |
| 74 | Ga0466722_175899 | 3300042609 | Bacteria | 3869 |
| 75 | Ga0466722_197142 | 3300042609 | Bacteria | 8548 |
| 76 | Ga0466712_137321 | 3300042614 | Bacteria | 2267 |
| 77 | Ga0466712_178547 | 3300042614 | Bacteria | 12495 |
| 78 | Ga0466715_238123 | 3300042616 | Bacteria | 9038 |
| 79 | Ga0466723_013566 | 3300042618 | Bacteria | 7029 |
| 80 | JGI24698J34947_10014247 | 3300002449 | Bacteria | 4330 |
| 81 | JGI24698J34947_10056821 | 3300002449 | Unclassified | 1944 |
| 82 | Ga0264413_129109 | 3300024493 | Bacteria | 4224 |
| 83 | Ga0466690_073261 | 3300042590 | Bacteria | 5050 |
| 84 | Ga0466694_036931 | 3300042594 | Bacteria | 4923 |
| 85 | Ga0466696_024799 | 3300042596 | Bacteria | 7180 |
| 86 | Ga0466696_307974 | 3300042596 | Bacteria | 34055 |
| 87 | Ga0466703_086078 | 3300042636 | Bacteria | 5196 |
| 88 | Ga0466703_155900 | 3300042636 | Bacteria | 4539 |
| 89 | Ga0466727_168863 | 3300042655 | Bacteria | 13700 |
| 90 | Ga0466705_126222 | 3300042612 | Bacteria | 8501 |
| 91 | Ga0466732_144955 | 3300042656 | Bacteria | 2718 |
| 92 | Ga0466721_363580 | 3300042608 | Bacteria | 32780 |
| 93 | Ga0466712_146169 | 3300042614 | Bacteria | 2206 |
| 94 | Ga0466711_211857 | 3300042615 | Bacteria | 2409 |
| 95 | Ga0466718_106785 | 3300042617 | Bacteria | 1306 |
| 96 | Ga0466723_001353 | 3300042618 | Bacteria | 3191 |
| 97 | Ga0466723_308593 | 3300042618 | Bacteria | 2027 |
| 98 | Ga0466726_287535 | 3300042619 | Bacteria | 15444 |
| 99 | Ga0072941_1018481 | 3300005201 | Bacteria | 5540 |
| 100 | Ga0072941_1059593 | 3300005201 | Bacteria | 24866 |
| 101 | Ga0466690_043424 | 3300042590 | Bacteria | 9296 |
| 102 | Ga0466694_105273 | 3300042594 | Bacteria | 1401 |
| 103 | Ga0466731_350908 | 3300042622 | Bacteria | 3084 |
| 104 | Ga0466703_097372 | 3300042636 | Bacteria | 4108 |
| 105 | Ga0466704_033321 | 3300042643 | Bacteria | 22698 |
| 106 | Ga0466704_614751 | 3300042643 | Bacteria | 1780 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07470 | Glyco_hydro_88 | Glycosyl Hydrolase Family 88 | 45 | 401 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.