Protein Family IF11792

Metagenome Metatranscriptome Isolate
219 Members
41 Samples
201 Scaffolds
332.12 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125659|2781326906|
Length
398 aa
Sequence
MSDIIYNEDRTANWGKISRNYHKKKKALEIIYKICRAILLFGLCFLIIQPLLDKISVSFMAEQDLYDSTVISIPRNFTMDNYKLAASREVLKYFPIIEKVDKNQDDFYYDDFYYEPVQERGLFQTLFGYGMDEGEKRGLWAFIQKLFGVDIQIGSLLQTILIVIISSILQIAACTLAAYGFARYKFPLKNFWFFCVMIIIVIPPQTIMASLYLNFHFFDIFGLFRLFTGEPINLLNSVWGLWLLSATGMGLKSGLYIFMLRQYFRGMPKELEEAAWVDGCGKFKTFIRIMLPDATPMLVSCFLFSFVWQWTDSFFSTLFLTNYDMLARRLGSIAERVGQYWAAVNAGTGAGVASAVPIGYVHAMMATGMLLCLLPLIILYLIAQKAFVESLSQTGIKM

πŸ“Š Sample Types

Isolate 7.8%
Metagenome 91.8%
MAG 0.0%
Metatranscriptome 0.5%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 53.8%
Unclassified 46.2%

🌳 Taxonomy

Archaea 0
Bacteria 205
Eukaryota 0
Viruses 0
Unclassified 14

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
11 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
12 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
13 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
17 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
18 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
19 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
20 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
21 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300021245 Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA Metatranscriptome Termitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
33 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
34 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
35 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
36 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
40 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
41 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466731_254827 3300042622 Bacteria 1820
2 Ga0466734_000556 3300042623 Unclassified 1662
3 Ga0466702_114520 3300042635 Bacteria 3333
4 Ga0466702_207292 3300042635 Bacteria 2641
5 Ga0466694_141698 3300042594 Bacteria 2999
6 Ga0466699_030982 3300042597 Bacteria 38155
7 Ga0466712_019843 3300042614 Bacteria 37103
8 Ga0466712_029943 3300042614 Bacteria 25964
9 Ga0466712_166485 3300042614 Bacteria 2157
10 Ga0466712_191566 3300042614 Bacteria 26176
11 Ga0466718_020623 3300042617 Bacteria 7762
12 Ga0466718_063288 3300042617 Bacteria 3791
13 Ga0123356_10004757 3300010049 Bacteria 13972
14 JGI24698J34947_10006048 3300002449 Bacteria 6647
15 JGI24698J34947_10076434 3300002449 Unclassified 1588
16 JGI24698J34947_10119784 3300002449 Bacteria 1145
17 JGI24695J34938_10000964 3300002450 Bacteria 26239
18 JGI24695J34938_10008991 3300002450 Bacteria 5619
19 Ga0072940_1020848 3300005200 Bacteria 7170
20 Ga0072941_1002740 3300005201 Bacteria 3234
21 Ga0072941_1006580 3300005201 Bacteria 25033
22 Ga0072941_1009679 3300005201 Bacteria 6649
23 Ga0072941_1013737 3300005201 Bacteria 13545
24 Ga0466720_005536 3300042607 Bacteria 5991
25 Ga0466732_005641 3300042656 Bacteria 25741
26 Ga0466702_148567 3300042635 Bacteria 6546
27 Ga0415639_014654 3300038395 Bacteria 2683
28 Ga0466694_069714 3300042594 Bacteria 1580
29 Ga0466694_108077 3300042594 Bacteria 9739
30 Ga0466694_193211 3300042594 Bacteria 8835
31 Ga0466694_212689 3300042594 Bacteria 44215
32 Ga0466699_026631 3300042597 Bacteria 5249
33 Ga0466699_270921 3300042597 Bacteria 7629
34 Ga0466699_377040 3300042597 Bacteria 2329
35 Ga0466712_319022 3300042614 Bacteria 2252
36 Ga0466718_131286 3300042617 Bacteria 12961
37 Ga0466718_163984 3300042617 Bacteria 3732
38 Ga0123356_10005491 3300010049 Bacteria 12902
39 Ga0123356_10005594 3300010049 Bacteria 12780
40 AustNasuHG_c1001426 3300000089 Bacteria 8542
41 AustNasuHG_c1003098 3300000089 Bacteria 6002
42 AustNasuHG_c1012704 3300000089 Bacteria 2904
43 JGI24698J34947_10005965 3300002449 Bacteria 6688
44 JGI24698J34947_10008428 3300002449 Bacteria 5662
45 JGI24695J34938_10000871 3300002450 Bacteria 27909
46 JGI24695J34938_10002759 3300002450 Bacteria 12902
47 JGI24695J34938_10025454 3300002450 Bacteria 2828
48 JGI24695J34938_10029116 3300002450 Bacteria 2587
49 JGI24695J34938_10039075 3300002450 Bacteria 2146
50 Ga0072941_1023074 3300005201 Bacteria 18146
51 Ga0466707_152499 3300042601 Bacteria 5077
52 Ga0466720_032884 3300042607 Bacteria 17466
53 Ga0466720_042657 3300042607 Bacteria 30011
54 Ga0466720_211888 3300042607 Bacteria 8302
55 Ga0415639_002511 3300038395 Bacteria 23923
56 Ga0466699_000679 3300042597 Bacteria 6906
57 Ga0466699_172393 3300042597 Bacteria 6448
58 Ga0466712_166730 3300042614 Bacteria 13711
59 Ga0466712_266224 3300042614 Bacteria 24891
60 Ga0466718_020962 3300042617 Bacteria 15897
61 Ga0466718_074576 3300042617 Bacteria 7052
62 Ga0466718_133035 3300042617 Bacteria 7313
63 Ga0123356_10134452 3300010049 Bacteria 2428
64 Ga0123356_10211150 3300010049 Bacteria 1990
65 AustNasuHG_c1019511 3300000089 Bacteria 2223
66 JGI24695J34938_10000474 3300002450 Bacteria 38967
67 JGI24695J34938_10010069 3300002450 Bacteria 5210
68 Ga0072941_1078496 3300005201 Bacteria 10395
69 Ga0466732_119652 3300042656 Bacteria 6592
70 Ga0466702_433758 3300042635 Unclassified 1222
71 Ga0264413_114721 3300024493 Bacteria 7218
72 Ga0264413_114722 3300024493 Unclassified 2779
73 Ga0415639_000864 3300038395 Bacteria 22210
74 Ga0415639_037982 3300038395 Bacteria 7102
75 Ga0415639_038004 3300038395 Bacteria 2638
76 Ga0466699_004513 3300042597 Bacteria 2673
77 Ga0466712_201567 3300042614 Bacteria 7869
78 Ga0466712_252323 3300042614 Bacteria 18721
79 Ga0123356_10000415 3300010049 Bacteria 48650
80 Ga0123356_10003113 3300010049 Bacteria 17506
81 Ga0123356_10031817 3300010049 Bacteria 4938
82 AustNasuHG_c1000453 3300000089 Bacteria 14360
83 AustNasuHG_c1007740 3300000089 Bacteria 3813
84 JGI24698J34947_10002090 3300002449 Bacteria 10675
85 JGI24698J34947_10023198 3300002449 Bacteria 3321
86 JGI24698J34947_10025050 3300002449 Bacteria 3178
87 JGI24698J34947_10028328 3300002449 Bacteria 2966
88 JGI24698J34947_10062049 3300002449 Bacteria 1837
89 JGI24695J34938_10000581 3300002450 Bacteria 35281
90 JGI24695J34938_10003704 3300002450 Bacteria 10447
91 JGI24695J34938_10009485 3300002450 Bacteria 5411
92 JGI24695J34938_10009746 3300002450 Unclassified 5317
93 JGI24695J34938_10029015 3300002450 Unclassified 2591
94 Ga0072940_1041510 3300005200 Bacteria 4161
95 Ga0072941_1002739 3300005201 Bacteria 9370
96 Ga0072941_1017721 3300005201 Bacteria 7222
97 Ga0466720_005396 3300042607 Bacteria 5991
98 Ga0466720_018172 3300042607 Bacteria 18310
99 Ga0466720_064604 3300042607 Bacteria 9993
100 Ga0466732_111019 3300042656 Bacteria 24226
101 Ga0466732_228097 3300042656 Unclassified 2386
102 Ga0466732_395551 3300042656 Bacteria 26916
103 Ga0466702_289577 3300042635 Bacteria 8018
104 Ga0223683_1001135 3300021245 Bacteria 2955
105 Ga0264413_105823 3300024493 Bacteria 11323
106 Ga0466699_128761 3300042597 Bacteria 23280
107 Ga0466718_006860 3300042617 Bacteria 24248
108 Ga0466718_009670 3300042617 Bacteria 18115
109 Ga0123356_10000943 3300010049 Bacteria 32172
110 Ga0123356_10009798 3300010049 Bacteria 9442
111 AustNasuHG_c1000061 3300000089 Bacteria 29194
112 AustNasuHG_c1002097 3300000089 Bacteria 7208
113 AustNasuHG_c1005115 3300000089 Unclassified 4689
114 AustNasuHG_c1006774 3300000089 Bacteria 4084
115 AustNasuHG_c1011969 3300000089 Bacteria 3000
116 JGI24698J34947_10002391 3300002449 Bacteria 10105
117 JGI24698J34947_10012887 3300002449 Bacteria 4570
118 JGI24698J34947_10017675 3300002449 Bacteria 3861
119 JGI24695J34938_10000707 3300002450 Bacteria 31446
120 JGI24695J34938_10001905 3300002450 Bacteria 16859
121 JGI24695J34938_10002812 3300002450 Bacteria 12719
122 JGI24695J34938_10007431 3300002450 Bacteria 6412
123 Ga0072941_1023073 3300005201 Bacteria 4572
124 Ga0072941_1057243 3300005201 Bacteria 4273
125 Ga0466707_125576 3300042601 Bacteria 1836
126 Ga0466720_083663 3300042607 Bacteria 1930
127 Ga0466732_210967 3300042656 Bacteria 3126
128 Ga0264413_115994 3300024493 Unclassified 1542
129 Ga0466693_083077 3300042592 Bacteria 4095
130 Ga0466718_018819 3300042617 Bacteria 2913
131 AustNasuHG_c1000108 3300000089 Bacteria 24878
132 AustNasuHG_c1001360 3300000089 Bacteria 8750
133 AustNasuHG_c1019075 3300000089 Unclassified 2255
134 AustNasuHG_c1026624 3300000089 Unclassified 1797
135 JGI24698J34947_10000947 3300002449 Bacteria 14770
136 JGI24698J34947_10018410 3300002449 Bacteria 3775
137 JGI24695J34938_10000912 3300002450 Bacteria 27225
138 JGI24695J34938_10002433 3300002450 Bacteria 14266
139 JGI24695J34938_10013612 3300002450 Bacteria 4260
140 JGI24699J35502_11133649 3300002509 Bacteria 12923
141 Ga0072940_1005046 3300005200 Bacteria 9941
142 Ga0072941_1001886 3300005201 Bacteria 139305
143 Ga0072941_1016269 3300005201 Bacteria 40017
144 Ga0466720_073097 3300042607 Bacteria 4199
145 Ga0466720_119639 3300042607 Bacteria 7913
146 Ga0466732_216081 3300042656 Bacteria 2231
147 Ga0466731_187755 3300042622 Bacteria 4040
148 Ga0264413_101049 3300024493 Bacteria 18252
149 Ga0466694_033736 3300042594 Bacteria 2846
150 Ga0466694_042205 3300042594 Bacteria 30345
151 Ga0466699_119092 3300042597 Bacteria 6981
152 Ga0466712_074518 3300042614 Bacteria 9948
153 Ga0466712_147932 3300042614 Bacteria 29015
154 Ga0466718_011694 3300042617 Bacteria 3751
155 Ga0466718_023786 3300042617 Bacteria 24556
156 Ga0466718_104789 3300042617 Bacteria 6046
157 Ga0123356_10000596 3300010049 Bacteria 40097
158 AustNasuHG_c1015815 3300000089 Bacteria 2538
159 JGI24698J34947_10000766 3300002449 Bacteria 15915
160 JGI24698J34947_10002084 3300002449 Bacteria 10696
161 JGI24698J34947_10020874 3300002449 Bacteria 3526
162 JGI24695J34938_10001655 3300002450 Bacteria 18530
163 JGI24695J34938_10003716 3300002450 Bacteria 10428
164 JGI24695J34938_10011152 3300002450 Unclassified 4861
165 Ga0072941_1002298 3300005201 Bacteria 33074
166 Ga0072941_1004244 3300005201 Bacteria 27886
167 Ga0072941_1008006 3300005201 Bacteria 25853
168 Ga0072941_1036448 3300005201 Bacteria 24164
169 Ga0072941_1074410 3300005201 Bacteria 8935
170 Ga0466720_018026 3300042607 Bacteria 1768
171 Ga0466720_094824 3300042607 Unclassified 3680
172 Ga0466732_370520 3300042656 Bacteria 1846
173 Ga0466731_012920 3300042622 Bacteria 154202
174 Ga0466702_264425 3300042635 Bacteria 7851
175 Ga0264413_100129 3300024493 Bacteria 16961
176 Ga0264413_105193 3300024493 Bacteria 48930
177 Ga0466694_029156 3300042594 Bacteria 68693
178 Ga0466694_110585 3300042594 Bacteria 11046
179 Ga0466712_023804 3300042614 Bacteria 31613
180 Ga0466712_036582 3300042614 Bacteria 15193
181 Ga0466712_163760 3300042614 Bacteria 16856
182 Ga0466718_165039 3300042617 Bacteria 21082
183 Ga0123355_10009862 3300009826 Bacteria 14573
184 Ga0123353_10615906 3300010167 Unclassified 1547
185 JGI24698J34947_10000223 3300002449 Bacteria 23530
186 JGI24698J34947_10000482 3300002449 Bacteria 18705
187 JGI24698J34947_10001124 3300002449 Bacteria 13831
188 JGI24698J34947_10004365 3300002449 Bacteria 7693
189 JGI24698J34947_10011132 3300002449 Bacteria 4937
190 JGI24698J34947_10013520 3300002449 Bacteria 4455
191 JGI24698J34947_10030339 3300002449 Bacteria 2852
192 JGI24695J34938_10000501 3300002450 Bacteria 38048
193 JGI24695J34938_10001109 3300002450 Bacteria 24296
194 JGI24695J34938_10001520 3300002450 Bacteria 19548
195 JGI24695J34938_10002885 3300002450 Bacteria 12518
196 Ga0072940_1045515 3300005200 Bacteria 2725
197 Ga0072941_1000566 3300005201 Bacteria 32587
198 Ga0072941_1000567 3300005201 Bacteria 17257
199 Ga0072941_1020136 3300005201 Bacteria 17867
200 Ga0466720_021109 3300042607 Bacteria 10070
201 Ga0466698_476313 3300042610 Bacteria 5358

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 177 388 0.77

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.