Protein Family IF11791

Metagenome Isolate
137 Members
51 Samples
119 Scaffolds
607.6 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125659|2781326728|
Length
700 aa
Sequence
LTKGSILIVPNSEPGQGGGHLTRCIKLARDLRSLGRETWLFITPQTRDLTNLYLSLNFNPAWCITNEELTIRNEKLGKTFDFIIMDRFQTPLDELIRWKNIAPVIGVDEGGKHRDKFNFLIDMLIPENFIHPPANIYSPHWLIDKHIIDNITTTQQNLELSELNNNHGVHGGTRRFLYEGSIFSENLQVLQNKDSKFKILISFGQEDKANLGNKIAKKLSTIKSNYPIEITLLKGSLNTNHSTFHIPHSTLSKHSTLKIIESIPNLALHLNEYNLLITHYGITAYEALFTGTPVILAHPTPYHKKLAKTAGFLDIKHLSSLIKRIKNHGELQPKLLGGTRKFWFENLFSSVNLRVLRVLRGKILTYTNLAETCNNLLLTVNRGCPVCGSGTSKTISRYNDRTYHRCFKCGIIYMDRTNLPPIEYEKEYFFESYKNQYGKTYLEDFDNIKESGKKRINIISKILNRGTETRWTRRENKDIESLKLLDIGCAYGPFLAAAKEANYSPFGIDPAEDAIKYVTETLNIPAIHSFFPLLHSTLNIPHSTLNKHSTLNIPHSTLLKNSTLNNNSYNVITLWFVIEHFTDCVSVLNEVKRLLKPGGLLAFSTPSFSGISGRSSIHRFLSKSPADHWTIWSPKSAKKALVITGFKVKKIVIVGHHPERFPVLGKLAKNKKSPVYWLLLIISKIFYLGDTFEVYAELNK

📊 Sample Types

Isolate 13.1%
Metagenome 86.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.8%
Termitidae 38.8%
Kalotermitidae 18.4%
Rhinotermitidae 4.1%

🌳 Taxonomy

Archaea 1
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
3 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
6 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
7 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
19 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
20 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
28 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
29 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
34 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
35 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
36 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
41 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
42 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
47 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
48 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
49 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
50 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_104465 3300042656 Bacteria 8406
2 Ga0466708_452394 3300042652 Bacteria 8545
3 Ga0123356_10000032 3300010049 Bacteria 154381
4 Ga0123356_10097384 3300010049 Bacteria 2815
5 Ga0466694_199924 3300042594 Bacteria 13991
6 AustNasuHG_c1013109 3300000089 Bacteria 2849
7 JGI24698J34947_10003538 3300002449 Bacteria 8480
8 JGI24698J34947_10007627 3300002449 Bacteria 5946
9 JGI24698J34947_10054756 3300002449 Bacteria 1990
10 JGI24695J34938_10000635 3300002450 Bacteria 33494
11 JGI24695J34938_10013291 3300002450 Bacteria 4330
12 Ga0466712_046969 3300042614 Bacteria 9843
13 Ga0466712_113211 3300042614 Bacteria 14585
14 Ga0466712_165953 3300042614 Bacteria 35107
15 Ga0466715_065500 3300042616 Bacteria 24099
16 Ga0123355_10155228 3300009826 Bacteria 3465
17 Ga0123356_10000504 3300010049 Bacteria 43651
18 Ga0466720_238860 3300042607 Bacteria 102895
19 Ga0466721_239644 3300042608 Bacteria 18017
20 Ga0466722_027937 3300042609 Bacteria 29446
21 Ga0466699_110498 3300042597 Bacteria 24920
22 AustNasuHG_c1000172 3300000089 Bacteria 20968
23 AustNasuHG_c1003312 3300000089 Bacteria 5811
24 JGI24695J34938_10000229 3300002450 Bacteria 53063
25 JGI24695J34938_10003009 3300002450 Bacteria 12113
26 JGI24702J35022_10029770 3300002462 Bacteria 2930
27 Ga0072941_1011111 3300005201 Bacteria 22501
28 Ga0466712_005338 3300042614 Bacteria 40115
29 Ga0466712_265690 3300042614 Bacteria 51797
30 Ga0466708_045919 3300042652 Bacteria 6164
31 Ga0466720_138529 3300042607 Bacteria 8511
32 Ga0264413_119998 3300024493 Bacteria 6895
33 Ga0466693_157196 3300042592 Bacteria 53244
34 Ga0466693_237474 3300042592 Bacteria 33903
35 JGI24698J34947_10001101 3300002449 Bacteria 13934
36 JGI24698J34947_10001134 3300002449 Bacteria 13806
37 JGI24698J34947_10004003 3300002449 Bacteria 8009
38 JGI24698J34947_10005317 3300002449 Bacteria 7064
39 JGI24695J34938_10000590 3300002450 Bacteria 34943
40 JGI24695J34938_10004823 3300002450 Unclassified 8671
41 JGI24695J34938_10025476 3300002450 Bacteria 2827
42 Ga0466712_204722 3300042614 Bacteria 2436
43 Ga0466712_310176 3300042614 Bacteria 26726
44 Ga0466718_012794 3300042617 Bacteria 11897
45 Ga0466718_094659 3300042617 Bacteria 3258
46 Ga0123356_10000204 3300010049 Bacteria 68773
47 Ga0123353_10100033 3300010167 Bacteria 4673
48 Ga0466720_043295 3300042607 Bacteria 7532
49 Ga0466720_064659 3300042607 Bacteria 13696
50 Ga0466691_106634 3300042593 Bacteria 18352
51 AustNasuHG_c1006220 3300000089 Bacteria 4268
52 JGI24698J34947_10000022 3300002449 Bacteria 40410
53 JGI24698J34947_10000216 3300002449 Bacteria 23797
54 JGI24698J34947_10009217 3300002449 Bacteria 5416
55 JGI24695J34938_10000016 3300002450 Bacteria 116336
56 JGI24695J34938_10002695 3300002450 Bacteria 13196
57 JGI24695J34938_10003627 3300002450 Bacteria 10606
58 Ga0466718_008561 3300042617 Bacteria 19760
59 Ga0466718_117275 3300042617 Bacteria 17730
60 Ga0466723_070615 3300042618 Bacteria 9806
61 Ga0123356_10125364 3300010049 Bacteria 2506
62 Ga0123353_10258596 3300010167 Bacteria 2691
63 Ga0466719_315195 3300042606 Bacteria 8891
64 Ga0466692_192135 3300042591 Bacteria 14735
65 AustNasuHG_c1002194 3300000089 Bacteria 7054
66 JGI24695J34938_10000031 3300002450 Bacteria 105176
67 Ga0072941_1004185 3300005201 Bacteria 50030
68 Ga0072941_1005156 3300005201 Bacteria 21941
69 Ga0072941_1021730 3300005201 Bacteria 3949
70 Ga0466712_070678 3300042614 Bacteria 18159
71 Ga0466712_243445 3300042614 Bacteria 16357
72 Ga0466712_256662 3300042614 Bacteria 11513
73 Ga0466718_048292 3300042617 Bacteria 18116
74 Ga0466718_064604 3300042617 Bacteria 11623
75 Ga0466718_073527 3300042617 Bacteria 14374
76 Ga0466718_076935 3300042617 Bacteria 9274
77 Ga0466732_199856 3300042656 Archaea 15051
78 Ga0466709_184041 3300042648 Bacteria 11210
79 Ga0466708_286706 3300042652 Bacteria 8164
80 Ga0415639_020882 3300038395 Bacteria 3990
81 Ga0466690_293165 3300042590 Bacteria 7074
82 Ga0466695_283924 3300042595 Bacteria 5253
83 JGI24698J34947_10010086 3300002449 Bacteria 5178
84 JGI24698J34947_10017442 3300002449 Bacteria 3891
85 Ga0072941_1006754 3300005201 Bacteria 15785
86 Ga0072941_1019668 3300005201 Bacteria 6412
87 Ga0466712_077971 3300042614 Bacteria 32694
88 Ga0466712_141117 3300042614 Bacteria 4403
89 Ga0466705_230051 3300042612 Bacteria 6659
90 Ga0466708_011864 3300042652 Bacteria 3175
91 Ga0123356_10000062 3300010049 Bacteria 112695
92 Ga0123356_10090690 3300010049 Bacteria 2911
93 Ga0466694_051976 3300042594 Bacteria 2580
94 Ga0466696_099839 3300042596 Bacteria 1991
95 AustNasuHG_c1000193 3300000089 Bacteria 20133
96 JGI24698J34947_10004890 3300002449 Bacteria 7341
97 JGI24698J34947_10007418 3300002449 Bacteria 6030
98 JGI24695J34938_10002857 3300002450 Bacteria 12586
99 JGI24695J34938_10013399 3300002450 Bacteria 4308
100 JGI24695J34938_10014500 3300002450 Bacteria 4083
101 JGI24695J34938_10017345 3300002450 Bacteria 3631
102 Ga0072941_1019666 3300005201 Bacteria 7092
103 Ga0466712_022445 3300042614 Bacteria 9404
104 Ga0466712_130010 3300042614 Bacteria 6904
105 Ga0466715_427231 3300042616 Bacteria 12547
106 Ga0466718_073355 3300042617 Bacteria 21623
107 Ga0466732_153424 3300042656 Bacteria 6614
108 Ga0123355_10013174 3300009826 Bacteria 12853
109 Ga0466707_081560 3300042601 Bacteria 4041
110 Ga0466698_117433 3300042610 Bacteria 21128
111 JGI24698J34947_10006608 3300002449 Bacteria 6373
112 JGI24698J34947_10041678 3300002449 Bacteria 2363
113 JGI24695J34938_10000012 3300002450 Bacteria 126955
114 JGI24695J34938_10000282 3300002450 Bacteria 50082
115 JGI24695J34938_10011288 3300002450 Bacteria 4819
116 Ga0072940_1033040 3300005200 Bacteria 7729
117 Ga0466712_065994 3300042614 Bacteria 33285
118 Ga0466712_122176 3300042614 Bacteria 31114
119 Ga0466712_173676 3300042614 Bacteria 5713

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08242 Methyltransf_12 Methyltransferase domain 485 601 0.95
PF13847 Methyltransf_31 Methyltransferase domain 559 607 0.84
PF13489 Methyltransf_23 Methyltransferase domain 477 648 0.83
PF08241 Methyltransf_11 Methyltransferase domain 485 603 0.83

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08241 GO:0008757 S-adenosylmethionine-dependent methyltransferase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.