Protein Family IF11771
Metagenome
Isolate
136
Members
48
Samples
119
Scaffolds
95.07
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125646|2781302138|
- Length
- 108 aa
- Sequence
- MKHCRKIASRKRVNQMNKKVNTLLFILGATTFNILMTVISFIILILLYIKFLIPLMPEANRSWGFSIIFLASIVISFFVYRYVLKFLISKIDIEKYFDPIFVKKYKKH
Sample Types
Isolate
12.5%
Metagenome
87.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.2%
Unclassified
37.8%
Kalotermitidae
8.9%
Termopsidae
8.9%
Rhinotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 2 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 3 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 4 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 5 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 6 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 23 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 34 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 35 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 39 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 40 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 41 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 46 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466718_091293 | 3300042617 | Bacteria | 1159 |
| 2 | Ga0123356_10001579 | 3300010049 | Bacteria | 25045 |
| 3 | Ga0123356_10482209 | 3300010049 | Bacteria | 1393 |
| 4 | AustNasuHG_c1000634 | 3300000089 | Bacteria | 12458 |
| 5 | JGI24698J34947_10001451 | 3300002449 | Bacteria | 12460 |
| 6 | JGI24698J34947_10058282 | 3300002449 | Bacteria | 1913 |
| 7 | Ga0466720_050522 | 3300042607 | Bacteria | 1445 |
| 8 | Ga0466712_013731 | 3300042614 | Bacteria | 21049 |
| 9 | Ga0123356_10004251 | 3300010049 | Bacteria | 14819 |
| 10 | Ga0123356_11294986 | 3300010049 | Bacteria | 892 |
| 11 | AustNasuHG_c1001067 | 3300000089 | Bacteria | 9853 |
| 12 | JGI24698J34947_10016662 | 3300002449 | Bacteria | 3987 |
| 13 | JGI24698J34947_10018190 | 3300002449 | Bacteria | 3800 |
| 14 | JGI24698J34947_10073617 | 3300002449 | Unclassified | 1630 |
| 15 | JGI24698J34947_10106675 | 3300002449 | Bacteria | 1246 |
| 16 | JGI24695J34938_10000697 | 3300002450 | Bacteria | 31714 |
| 17 | JGI24695J34938_10010182 | 3300002450 | Bacteria | 5175 |
| 18 | JGI24695J34938_10241771 | 3300002450 | Bacteria | 763 |
| 19 | Ga0466719_196831 | 3300042606 | Bacteria | 2512 |
| 20 | Ga0466720_014309 | 3300042607 | Bacteria | 1176 |
| 21 | Ga0466735_137056 | 3300042624 | Bacteria | 11891 |
| 22 | Ga0466735_175796 | 3300042624 | Bacteria | 1283 |
| 23 | Ga0466702_072385 | 3300042635 | Bacteria | 1017 |
| 24 | Ga0466702_327158 | 3300042635 | Bacteria | 1221 |
| 25 | Ga0466712_117617 | 3300042614 | Unclassified | 1071 |
| 26 | Ga0466715_270505 | 3300042616 | Bacteria | 15014 |
| 27 | Ga0123356_10012357 | 3300010049 | Bacteria | 8290 |
| 28 | AustNasuHG_c1000256 | 3300000089 | Bacteria | 18107 |
| 29 | FAAS_10003187 | 3300001880 | Bacteria | 1557 |
| 30 | JGI24695J34938_10488345 | 3300002450 | Bacteria | 561 |
| 31 | JGI24702J35022_10123326 | 3300002462 | Bacteria | 1433 |
| 32 | JGI24697J35500_11104755 | 3300002507 | Bacteria | 1178 |
| 33 | Ga0072941_1072220 | 3300005201 | Bacteria | 5834 |
| 34 | Ga0072941_1085995 | 3300005201 | Bacteria | 877 |
| 35 | Ga0466734_032160 | 3300042623 | Bacteria | 1600 |
| 36 | Ga0466732_183131 | 3300042656 | Bacteria | 4915 |
| 37 | Ga0264413_125979 | 3300024493 | Bacteria | 1515 |
| 38 | Ga0264413_127263 | 3300024493 | Bacteria | 1183 |
| 39 | Ga0466694_205754 | 3300042594 | Bacteria | 7559 |
| 40 | Ga0466726_237274 | 3300042619 | Bacteria | 4143 |
| 41 | Ga0123356_10000073 | 3300010049 | Bacteria | 106706 |
| 42 | Ga0123356_10000685 | 3300010049 | Bacteria | 37562 |
| 43 | Ga0123356_10002277 | 3300010049 | Bacteria | 20698 |
| 44 | Ga0123356_12526734 | 3300010049 | Bacteria | 643 |
| 45 | JGI24698J34947_10019071 | 3300002449 | Bacteria | 3704 |
| 46 | JGI24698J34947_10025645 | 3300002449 | Bacteria | 3136 |
| 47 | JGI24698J34947_10072143 | 3300002449 | Bacteria | 1654 |
| 48 | JGI24695J34938_10032496 | 3300002450 | Bacteria | 2410 |
| 49 | JGI24697J35500_11271337 | 3300002507 | Bacteria | 4483 |
| 50 | Ga0072941_1085364 | 3300005201 | Bacteria | 3875 |
| 51 | Ga0466720_146539 | 3300042607 | Bacteria | 24774 |
| 52 | Ga0466720_220379 | 3300042607 | Bacteria | 9532 |
| 53 | Ga0466731_073695 | 3300042622 | Bacteria | 2289 |
| 54 | Ga0466702_455567 | 3300042635 | Bacteria | 1169 |
| 55 | Ga0466727_275426 | 3300042655 | Bacteria | 5678 |
| 56 | Ga0456237_0004532 | 3300041968 | Bacteria | 2229 |
| 57 | Ga0123356_10006775 | 3300010049 | Bacteria | 11527 |
| 58 | Ga0123356_10982774 | 3300010049 | Bacteria | 1014 |
| 59 | JGI24698J34947_10005145 | 3300002449 | Bacteria | 7166 |
| 60 | JGI24698J34947_10161326 | 3300002449 | Unclassified | 918 |
| 61 | JGI24695J34938_10000327 | 3300002450 | Bacteria | 46825 |
| 62 | JGI24695J34938_10000407 | 3300002450 | Bacteria | 41969 |
| 63 | JGI24695J34938_10003137 | 3300002450 | Bacteria | 11779 |
| 64 | JGI24695J34938_10003562 | 3300002450 | Bacteria | 10739 |
| 65 | JGI24695J34938_10040977 | 3300002450 | Unclassified | 2082 |
| 66 | Ga0068302_10204022 | 3300005071 | Bacteria | 2019 |
| 67 | Ga0072941_1040782 | 3300005201 | Bacteria | 3835 |
| 68 | Ga0466714_108781 | 3300042603 | Bacteria | 2032 |
| 69 | Ga0466731_230695 | 3300042622 | Bacteria | 1270 |
| 70 | Ga0466731_413704 | 3300042622 | Bacteria | 40616 |
| 71 | Ga0466702_184979 | 3300042635 | Bacteria | 3385 |
| 72 | Ga0466703_383418 | 3300042636 | Bacteria | 6060 |
| 73 | Ga0264413_110043 | 3300024493 | Bacteria | 1887 |
| 74 | Ga0415639_035618 | 3300038395 | Bacteria | 8096 |
| 75 | Ga0466712_039960 | 3300042614 | Bacteria | 1027 |
| 76 | Ga0123356_10008960 | 3300010049 | Bacteria | 9905 |
| 77 | Ga0123356_10017145 | 3300010049 | Bacteria | 6893 |
| 78 | JGI24698J34947_10001175 | 3300002449 | Bacteria | 13651 |
| 79 | JGI24695J34938_10000003 | 3300002450 | Bacteria | 167365 |
| 80 | JGI24695J34938_10001640 | 3300002450 | Bacteria | 18661 |
| 81 | JGI24695J34938_10044697 | 3300002450 | Bacteria | 1969 |
| 82 | Ga0072940_1061654 | 3300005200 | Bacteria | 3048 |
| 83 | Ga0072940_1251724 | 3300005200 | Bacteria | 611 |
| 84 | Ga0072941_1006515 | 3300005201 | Bacteria | 11251 |
| 85 | Ga0466694_077836 | 3300042594 | Bacteria | 37129 |
| 86 | Ga0466712_038979 | 3300042614 | Bacteria | 34069 |
| 87 | Ga0466712_074898 | 3300042614 | Bacteria | 22433 |
| 88 | Ga0466712_120003 | 3300042614 | Bacteria | 2086 |
| 89 | Ga0466712_195821 | 3300042614 | Bacteria | 17019 |
| 90 | Ga0123356_12457887 | 3300010049 | Bacteria | 652 |
| 91 | JGI24695J34938_10002948 | 3300002450 | Bacteria | 12304 |
| 92 | JGI24695J34938_10003607 | 3300002450 | Bacteria | 10634 |
| 93 | JGI24695J34938_10034371 | 3300002450 | Bacteria | 2326 |
| 94 | JGI24695J34938_10174271 | 3300002450 | Bacteria | 888 |
| 95 | Ga0072940_1069226 | 3300005200 | Bacteria | 1211 |
| 96 | Ga0072941_1045616 | 3300005201 | Bacteria | 4230 |
| 97 | Ga0072941_1157623 | 3300005201 | Bacteria | 1527 |
| 98 | Ga0072941_1158004 | 3300005201 | Bacteria | 1172 |
| 99 | Ga0466717_189711 | 3300042604 | Bacteria | 1186 |
| 100 | Ga0466735_231541 | 3300042624 | Bacteria | 2222 |
| 101 | Ga0466702_099779 | 3300042635 | Bacteria | 1582 |
| 102 | Ga0466727_299113 | 3300042655 | Bacteria | 2465 |
| 103 | Ga0466693_187683 | 3300042592 | Bacteria | 64758 |
| 104 | Ga0466694_053716 | 3300042594 | Bacteria | 43548 |
| 105 | Ga0466712_012815 | 3300042614 | Bacteria | 9246 |
| 106 | Ga0466712_064359 | 3300042614 | Bacteria | 30896 |
| 107 | Ga0466712_294812 | 3300042614 | Bacteria | 16205 |
| 108 | Ga0466711_231842 | 3300042615 | Bacteria | 4590 |
| 109 | Ga0466718_114371 | 3300042617 | Bacteria | 1545 |
| 110 | Ga0123356_10009396 | 3300010049 | Bacteria | 9659 |
| 111 | Ga0123356_10019895 | 3300010049 | Bacteria | 6358 |
| 112 | Ga0123356_10875352 | 3300010049 | Bacteria | 1069 |
| 113 | AustNasuHG_c1038544 | 3300000089 | Bacteria | 1201 |
| 114 | JGI24695J34938_10000126 | 3300002450 | Bacteria | 68489 |
| 115 | JGI24695J34938_10000976 | 3300002450 | Bacteria | 26065 |
| 116 | JGI24697J35500_11274167 | 3300002507 | Bacteria | 6662 |
| 117 | Ga0466720_221088 | 3300042607 | Bacteria | 31188 |
| 118 | Ga0466735_047791 | 3300042624 | Bacteria | 1176 |
| 119 | Ga0466727_207081 | 3300042655 | Bacteria | 2290 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.