Protein Family IF11766

Metagenome Isolate
167 Members
48 Samples
147 Scaffolds
271.19 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125644|2781296962|
Length
311 aa
Sequence
MVPAKGREGFMKIKLPELFSAKTHRRKGIKKDGILIKKRKLLDALLYGVMAFAMSGVILSLLFVLIYIFRSQAGFLNWKFLTDAHTGILPMIVTTLYVVLVSIAAAIPAGLAAAIFLNEYSGNSSFIRILRLAIETLAGIPSIIYGLFGLLLFCRLLNFGQSIIAGSLTLSIMILPVIIRTTEESLKSIPDSFREGSLALGATKFQTIAHVVLPSALPGILTSVILAIGRVIGESAPVLLTVGLAKNMPRSIFESGRTLTIHLFYLTNEAVRPEDFGIAFATASVLVILVVIINTAAKIITANFRKKLGDI

📊 Sample Types

Isolate 12.0%
Metagenome 88.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 43.5%
Termitidae 43.5%
Kalotermitidae 10.9%
Rhinotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
11 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
12 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
13 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
18 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
19 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
20 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
21 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
22 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
23 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
30 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
35 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
36 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
37 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
38 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
39 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
44 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
45 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
46 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 AustNasuHG_c1013232 3300000089 Unclassified 2833
2 AustNasuHG_c1028060 3300000089 Unclassified 1694
3 JGI24698J34947_10020555 3300002449 Unclassified 3554
4 JGI24698J34947_10020757 3300002449 Bacteria 3537
5 JGI24698J34947_10055304 3300002449 Unclassified 1978
6 JGI24695J34938_10000089 3300002450 Bacteria 79818
7 JGI24695J34938_10000272 3300002450 Bacteria 50568
8 JGI24695J34938_10003138 3300002450 Bacteria 11769
9 Ga0072941_1002429 3300005201 Bacteria 39736
10 Ga0072941_1018360 3300005201 Bacteria 13367
11 Ga0264413_112819 3300024493 Unclassified 2382
12 Ga0264413_117454 3300024493 Bacteria 4047
13 Ga0415639_016653 3300038395 Bacteria 5116
14 Ga0466694_024253 3300042594 Bacteria 20540
15 Ga0123355_10315669 3300009826 Bacteria 2112
16 Ga0123356_10150554 3300010049 Bacteria 2309
17 Ga0123356_10409842 3300010049 Bacteria 1495
18 Ga0466722_086766 3300042609 Bacteria 2001
19 Ga0466712_080324 3300042614 Bacteria 1818
20 Ga0466718_033184 3300042617 Bacteria 15825
21 Ga0466723_077145 3300042618 Bacteria 54484
22 AustNasuHG_c1002869 3300000089 Bacteria 6225
23 AustNasuHG_c1002957 3300000089 Bacteria 6121
24 AustNasuHG_c1022164 3300000089 Unclassified 2045
25 JGI24698J34947_10040976 3300002449 Unclassified 2388
26 JGI24695J34938_10001279 3300002450 Bacteria 22067
27 JGI24695J34938_10004337 3300002450 Bacteria 9345
28 JGI24695J34938_10010487 3300002450 Bacteria 5066
29 Ga0072941_1006601 3300005201 Bacteria 4621
30 Ga0466693_104074 3300042592 Bacteria 2139
31 Ga0466694_069492 3300042594 Bacteria 12714
32 Ga0466694_089443 3300042594 Bacteria 8323
33 Ga0123353_10291152 3300010167 Bacteria 2500
34 Ga0466719_370453 3300042606 Bacteria 7514
35 Ga0466720_142060 3300042607 Bacteria 3573
36 Ga0466721_162213 3300042608 Bacteria 3519
37 Ga0466722_132267 3300042609 Bacteria 39034
38 Ga0466712_006852 3300042614 Unclassified 1334
39 Ga0466715_072755 3300042616 Bacteria 13115
40 JGI24698J34947_10007146 3300002449 Bacteria 6135
41 JGI24698J34947_10045949 3300002449 Bacteria 2224
42 JGI24698J34947_10063707 3300002449 Bacteria 1805
43 JGI24695J34938_10003973 3300002450 Bacteria 9969
44 JGI24695J34938_10005716 3300002450 Bacteria 7674
45 JGI24695J34938_10006250 3300002450 Bacteria 7223
46 JGI24695J34938_10039296 3300002450 Bacteria 2139
47 JGI24695J34938_10069664 3300002450 Bacteria 1474
48 Ga0466693_028114 3300042592 Bacteria 110002
49 Ga0466699_240040 3300042597 Bacteria 1329
50 Ga0466699_367916 3300042597 Bacteria 2334
51 Ga0123356_10002033 3300010049 Bacteria 21839
52 Ga0123356_10058742 3300010049 Unclassified 3587
53 Ga0123356_10203435 3300010049 Bacteria 2022
54 Ga0123356_10334491 3300010049 Bacteria 1632
55 Ga0123356_10686830 3300010049 Bacteria 1192
56 Ga0466712_000555 3300042614 Unclassified 6675
57 Ga0466712_009546 3300042614 Bacteria 12932
58 Ga0466718_017520 3300042617 Bacteria 1446
59 Ga0466718_120716 3300042617 Bacteria 5164
60 JGI24698J34947_10055832 3300002449 Bacteria 1966
61 JGI24695J34938_10004974 3300002450 Bacteria 8482
62 JGI24695J34938_10011385 3300002450 Bacteria 4794
63 JGI24695J34938_10055654 3300002450 Bacteria 1709
64 JGI24695J34938_10057203 3300002450 Bacteria 1677
65 JGI24695J34938_10076748 3300002450 Bacteria 1387
66 Ga0264413_115370 3300024493 Bacteria 7040
67 Ga0415639_016678 3300038395 Bacteria 1979
68 Ga0466694_005840 3300042594 Bacteria 106514
69 Ga0466694_156129 3300042594 Bacteria 74614
70 Ga0466699_228025 3300042597 Bacteria 6350
71 Ga0123355_10894141 3300009826 Bacteria 966
72 Ga0123356_10005713 3300010049 Bacteria 12635
73 Ga0123356_10008085 3300010049 Bacteria 10473
74 Ga0123356_10097280 3300010049 Bacteria 2816
75 Ga0466717_287794 3300042604 Bacteria 2169
76 Ga0466720_017016 3300042607 Unclassified 8594
77 Ga0466718_096894 3300042617 Unclassified 2559
78 Ga0466723_243688 3300042618 Bacteria 83097
79 Ga0466702_123252 3300042635 Bacteria 9310
80 Ga0466702_123296 3300042635 Bacteria 1347
81 JGI24695J34938_10004375 3300002450 Bacteria 9306
82 JGI24695J34938_10024576 3300002450 Bacteria 2892
83 Ga0264413_102956 3300024493 Bacteria 4454
84 Ga0415639_005305 3300038395 Bacteria 16909
85 Ga0466690_070451 3300042590 Bacteria 8081
86 Ga0466720_052911 3300042607 Bacteria 5009
87 Ga0466720_080343 3300042607 Bacteria 15819
88 Ga0466720_115567 3300042607 Bacteria 8267
89 Ga0466712_015925 3300042614 Bacteria 11922
90 Ga0466712_030703 3300042614 Bacteria 18975
91 Ga0466712_121516 3300042614 Bacteria 3369
92 Ga0466712_183286 3300042614 Bacteria 15136
93 Ga0466718_037580 3300042617 Bacteria 5402
94 Ga0466731_164817 3300042622 Bacteria 2019
95 Ga0466704_233633 3300042643 Bacteria 14067
96 AustNasuHG_c1047673 3300000089 Unclassified 952
97 JGI24698J34947_10029092 3300002449 Unclassified 2921
98 JGI24695J34938_10000098 3300002450 Bacteria 76790
99 JGI24695J34938_10000369 3300002450 Bacteria 44536
100 Ga0466693_238451 3300042592 Bacteria 2288
101 Ga0466699_268122 3300042597 Bacteria 3584
102 Ga0123356_10002571 3300010049 Bacteria 19353
103 Ga0123353_10382865 3300010167 Bacteria 2103
104 Ga0466720_122506 3300042607 Bacteria 2936
105 Ga0466720_129874 3300042607 Bacteria 9649
106 Ga0466712_108456 3300042614 Unclassified 1451
107 Ga0466702_051437 3300042635 Bacteria 3231
108 Ga0466702_218285 3300042635 Bacteria 19292
109 AustNasuHG_c1006968 3300000089 Bacteria 4028
110 JGI24698J34947_10027941 3300002449 Bacteria 2991
111 JGI24698J34947_10036932 3300002449 Unclassified 2541
112 JGI24695J34938_10000035 3300002450 Bacteria 102136
113 JGI24695J34938_10002750 3300002450 Bacteria 12940
114 JGI24695J34938_10012382 3300002450 Bacteria 4522
115 JGI24695J34938_10023809 3300002450 Bacteria 2947
116 JGI24695J34938_10034589 3300002450 Bacteria 2318
117 JGI24702J35022_10017526 3300002462 Bacteria 3912
118 Ga0072941_1002394 3300005201 Bacteria 13768
119 Ga0264413_101415 3300024493 Bacteria 18677
120 Ga0466694_326988 3300042594 Bacteria 2042
121 Ga0123356_10033779 3300010049 Bacteria 4784
122 Ga0123356_10040637 3300010049 Bacteria 4333
123 Ga0466720_027749 3300042607 Bacteria 6026
124 Ga0466720_096417 3300042607 Unclassified 1074
125 Ga0466720_160428 3300042607 Unclassified 1144
126 Ga0466712_298591 3300042614 Bacteria 10678
127 Ga0466718_045669 3300042617 Bacteria 6335
128 Ga0466718_057716 3300042617 Bacteria 8922
129 Ga0466718_137107 3300042617 Unclassified 1912
130 Ga0466718_142257 3300042617 Bacteria 1234
131 Ga0466732_303487 3300042656 Bacteria 11255
132 AustNasuHG_c1000303 3300000089 Bacteria 17120
133 AustNasuHG_c1002050 3300000089 Bacteria 7271
134 JGI24695J34938_10000368 3300002450 Bacteria 44588
135 JGI24695J34938_10001867 3300002450 Bacteria 17119
136 JGI24695J34938_10004340 3300002450 Bacteria 9341
137 JGI24695J34938_10041781 3300002450 Bacteria 2057
138 Ga0072940_1027797 3300005200 Bacteria 5524
139 Ga0072941_1002428 3300005201 Bacteria 2853
140 Ga0072941_1006603 3300005201 Bacteria 3068
141 Ga0072941_1009285 3300005201 Bacteria 25402
142 Ga0466694_084177 3300042594 Bacteria 1362
143 Ga0466699_213584 3300042597 Unclassified 1336
144 Ga0123356_10000349 3300010049 Bacteria 53319
145 Ga0466712_319512 3300042614 Bacteria 9452
146 Ga0466718_052515 3300042617 Bacteria 9284
147 Ga0466702_414369 3300042635 Bacteria 5752

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 107 304 0.86

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.