Protein Family IF11740

Metagenome Isolate
209 Members
60 Samples
191 Scaffolds
633.17 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125632|2781269343|
Length
771 aa
Sequence
MMAGKAKEAAKPKKGILARAEAVKKAETNSKTTTAKAKTVGGKAAGKAKKPAEKTAGTKAAKTEAKPARPKAAAPAKAAAKPAAKARGVKPAAAKKAPAKQPAAKTAAAKAPAVKAPLAKAAAAKTPPTKAAAAKASPAKAAAAAKAPPAKDSPAKKPPVKTLSAKAPAGAKGVYDESKITTLSSLEHIRLRTGMYIGRLGDGSNPDDGIYILLKEVIDNGIDEFIMGNGKLIDIVVKXGTVKVRDFGRGIPLGKLVDCVSVINTGAKYNDDVFQFSVGLNGVGTKAVNALSSHFRVVAIRDGEFAEAVFQRGDLISERKGRLKDKQKNGTFVEFTPDRDIFGDYEFNPEFIEKRIQNYAYLNMGLTLSYNGKPFVSERGLFDLLTEETGDDGLYSVGYYRGTHIECAFTHTNNYGEGYFSFVNGQYTSDGGTHLSAFKEGFLKGIQTYFKKDYRSEDIREGSIAAVAVKLKNPIFESQTKNKLGNSDIRGWIVQEVKEAVEDWLHKNTDAAKKLELKILANESLRTELNQVKKEAREAAKKIALKIPKLKDCKYHLDDGKEGEFSTIFITEGDSASGSMVSSRDVMTQAIFALRGKVENMYGKKRAAIYKNEELYNMMMALGIENDVSGLRYGRIVIATDADFDGFHIRNLLLTFFLSYFEELVTGGRIYILETPLFRVRTKKETRYCYNANERDAAVSDLGTNSEVTRFKGLGEINPKEFGQFIGEDMRLVPVSVNTLKAVPQVLSFYMGKNTPERREYIMKNLIEDAG

📊 Sample Types

Isolate 8.6%
Metagenome 91.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 33.9%
Termitidae 32.2%
Kalotermitidae 23.7%
Rhinotermitidae 3.4%
Termopsidae 3.4%
Hodotermitidae 1.7%
Blaberidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 200
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
2 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
3 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
4 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
5 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
6 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
7 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
8 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
9 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
10 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
16 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
17 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
18 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
27 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
34 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
39 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
40 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
41 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
42 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
43 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
44 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
45 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
46 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
47 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
48 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
49 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
50 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
51 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
56 2772190975 Treponema sp. RmG30 Isolate Blaberidae
57 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
58 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
59 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
60 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_057218 3300042616 Bacteria 18099
2 Ga0466723_140722 3300042618 Bacteria 5328
3 Ga0466723_253618 3300042618 Bacteria 11361
4 Ga0466726_274906 3300042619 Bacteria 13849
5 Ga0466728_057850 3300042620 Bacteria 12334
6 Ga0466728_446144 3300042620 Bacteria 2926
7 Ga0466705_217545 3300042612 Bacteria 10546
8 Ga0466690_129314 3300042590 Bacteria 2081
9 Ga0466691_022408 3300042593 Bacteria 7241
10 Ga0466691_058158 3300042593 Bacteria 11018
11 Ga0466696_249661 3300042596 Bacteria 7303
12 Ga0466696_350007 3300042596 Bacteria 15628
13 Ga0466699_076644 3300042597 Bacteria 9216
14 Ga0466699_221331 3300042597 Bacteria 8319
15 Ga0466699_314935 3300042597 Bacteria 35477
16 Ga0466706_282825 3300042599 Bacteria 3533
17 Ga0466719_211142 3300042606 Bacteria 3962
18 Ga0466720_237359 3300042607 Bacteria 10851
19 JGI24698J34947_10000636 3300002449 Bacteria 16933
20 JGI24695J34938_10000333 3300002450 Bacteria 46505
21 JGI24695J34938_10003067 3300002450 Bacteria 11959
22 JGI24695J34938_10004010 3300002450 Bacteria 9906
23 JGI24700J35501_10928378 3300002508 Bacteria 7619
24 Ga0068305_10010468 3300005083 Bacteria 17327
25 Ga0466703_056379 3300042636 Bacteria 4492
26 Ga0466703_155675 3300042636 Bacteria 11749
27 Ga0466703_273540 3300042636 Bacteria 18168
28 Ga0466704_050836 3300042643 Bacteria 3849
29 Ga0466708_064367 3300042652 Bacteria 7957
30 Ga0466715_099077 3300042616 Bacteria 30278
31 Ga0466715_513480 3300042616 Bacteria 13111
32 Ga0466718_018672 3300042617 Bacteria 6383
33 Ga0466718_023428 3300042617 Bacteria 58531
34 Ga0466718_033214 3300042617 Bacteria 15252
35 Ga0466723_020994 3300042618 Bacteria 11359
36 Ga0466723_046495 3300042618 Bacteria 25534
37 Ga0466728_030019 3300042620 Bacteria 50626
38 Ga0123356_10001906 3300010049 Bacteria 22621
39 Ga0123353_10133986 3300010167 Bacteria 3975
40 Ga0466690_205943 3300042590 Unclassified 2980
41 Ga0466691_123277 3300042593 Bacteria 16326
42 Ga0466694_248957 3300042594 Bacteria 11620
43 Ga0466699_018112 3300042597 Bacteria 30293
44 Ga0466707_075499 3300042601 Bacteria 5533
45 Ga0466719_403247 3300042606 Bacteria 20432
46 Ga0466722_023990 3300042609 Bacteria 14966
47 Ga0466722_086541 3300042609 Bacteria 17160
48 JGI24698J34947_10013628 3300002449 Unclassified 4434
49 JGI24702J35022_10000918 3300002462 Bacteria 18353
50 Ga0466704_116228 3300042643 Bacteria 20763
51 Ga0466711_012004 3300042615 Bacteria 25076
52 Ga0466711_181000 3300042615 Bacteria 4224
53 Ga0466715_021532 3300042616 Bacteria 26806
54 Ga0466726_018474 3300042619 Bacteria 4718
55 Ga0466726_146029 3300042619 Bacteria 2201
56 Ga0466705_091697 3300042612 Bacteria 9285
57 Ga0123356_10001382 3300010049 Bacteria 26896
58 Ga0123354_10029597 3300010882 Bacteria 8609
59 Ga0466690_022919 3300042590 Bacteria 16488
60 Ga0466696_278448 3300042596 Bacteria 8016
61 Ga0466719_265799 3300042606 Bacteria 13261
62 Ga0466719_297647 3300042606 Bacteria 41658
63 Ga0466722_107644 3300042609 Bacteria 17605
64 JGI24698J34947_10000005 3300002449 Bacteria 60180
65 JGI24698J34947_10005576 3300002449 Bacteria 6907
66 JGI24695J34938_10009337 3300002450 Unclassified 5462
67 Ga0123357_10000428 3300009784 Bacteria 40312
68 Ga0466731_188578 3300042622 Bacteria 6932
69 Ga0466703_102891 3300042636 Bacteria 28156
70 Ga0466704_515711 3300042643 Bacteria 17863
71 Ga0466709_420056 3300042648 Unclassified 3922
72 Ga0466708_189995 3300042652 Bacteria 3891
73 Ga0466727_064818 3300042655 Bacteria 17843
74 Ga0466711_038496 3300042615 Bacteria 33651
75 Ga0466711_200090 3300042615 Bacteria 10192
76 Ga0466723_107314 3300042618 Bacteria 7786
77 Ga0123356_10000067 3300010049 Bacteria 109410
78 Ga0466691_086793 3300042593 Bacteria 17578
79 Ga0466691_134352 3300042593 Unclassified 6849
80 Ga0466694_034901 3300042594 Bacteria 2402
81 Ga0466699_425188 3300042597 Bacteria 97421
82 Ga0466706_048280 3300042599 Bacteria 2038
83 Ga0466716_072069 3300042605 Bacteria 16699
84 Ga0466716_085910 3300042605 Bacteria 8625
85 Ga0466719_169635 3300042606 Bacteria 10571
86 Ga0466720_072888 3300042607 Bacteria 21485
87 Ga0466722_171179 3300042609 Bacteria 13531
88 JGI24695J34938_10000187 3300002450 Bacteria 58138
89 Ga0466703_251690 3300042636 Bacteria 21578
90 Ga0466708_005306 3300042652 Bacteria 20730
91 Ga0466708_315444 3300042652 Bacteria 7468
92 Ga0466711_306002 3300042615 Bacteria 5080
93 Ga0466723_295723 3300042618 Bacteria 6317
94 Ga0466726_422565 3300042619 Bacteria 15199
95 Ga0123356_10044528 3300010049 Bacteria 4131
96 Ga0264413_111878 3300024493 Bacteria 7596
97 Ga0466691_086211 3300042593 Bacteria 36200
98 Ga0466691_120171 3300042593 Bacteria 13523
99 Ga0466694_156129 3300042594 Bacteria 74614
100 Ga0466696_115178 3300042596 Bacteria 23824
101 Ga0466696_213610 3300042596 Bacteria 9793
102 Ga0466699_319853 3300042597 Bacteria 10161
103 Ga0466722_149092 3300042609 Bacteria 2631
104 JGI24698J34947_10005602 3300002449 Bacteria 6887
105 JGI24695J34938_10000023 3300002450 Bacteria 110103
106 JGI24695J34938_10002809 3300002450 Bacteria 12738
107 JGI24695J34938_10008156 3300002450 Bacteria 6018
108 JGI24702J35022_10013281 3300002462 Bacteria 4562
109 Ga0466703_020566 3300042636 Bacteria 18585
110 Ga0466703_021411 3300042636 Bacteria 3026
111 Ga0466704_122002 3300042643 Bacteria 30457
112 Ga0466704_460023 3300042643 Bacteria 17910
113 Ga0466704_465796 3300042643 Bacteria 55836
114 Ga0466709_123880 3300042648 Bacteria 9198
115 Ga0466708_141530 3300042652 Bacteria 19881
116 Ga0466712_104225 3300042614 Bacteria 8519
117 Ga0466715_288158 3300042616 Bacteria 15475
118 Ga0466718_074631 3300042617 Bacteria 11598
119 Ga0466723_332765 3300042618 Bacteria 21737
120 Ga0466733_100386 3300042659 Bacteria 91702
121 Ga0123356_10023191 3300010049 Bacteria 5845
122 Ga0123353_10102701 3300010167 Bacteria 4608
123 Ga0466692_138507 3300042591 Bacteria 28367
124 Ga0466719_288901 3300042606 Bacteria 4098
125 Ga0466719_365900 3300042606 Bacteria 25712
126 Ga0466721_363580 3300042608 Bacteria 32780
127 JGI24698J34947_10000457 3300002449 Bacteria 19041
128 JGI24695J34938_10000852 3300002450 Bacteria 28276
129 JGI24695J34938_10001877 3300002450 Bacteria 17078
130 JGI24695J34938_10004046 3300002450 Unclassified 9830
131 JGI24695J34938_10006343 3300002450 Bacteria 7140
132 JGI24695J34938_10016295 3300002450 Bacteria 3784
133 Ga0466731_021153 3300042622 Bacteria 18900
134 Ga0466703_356192 3300042636 Bacteria 6048
135 Ga0466708_437744 3300042652 Bacteria 51835
136 Ga0466712_055787 3300042614 Bacteria 25522
137 Ga0466712_170040 3300042614 Bacteria 2997
138 Ga0466712_217249 3300042614 Bacteria 27211
139 Ga0466712_276239 3300042614 Unclassified 12034
140 Ga0466711_033203 3300042615 Bacteria 2096
141 Ga0466711_459410 3300042615 Bacteria 3997
142 Ga0466715_073075 3300042616 Bacteria 10469
143 Ga0466715_084745 3300042616 Bacteria 6984
144 Ga0466715_181917 3300042616 Bacteria 5321
145 Ga0466726_344886 3300042619 Bacteria 3327
146 Ga0466728_055216 3300042620 Bacteria 6065
147 Ga0466728_083040 3300042620 Bacteria 7752
148 Ga0466705_076692 3300042612 Unclassified 3601
149 Ga0466705_206488 3300042612 Bacteria 22408
150 Ga0123356_10015315 3300010049 Bacteria 7352
151 Ga0123353_10032110 3300010167 Bacteria 8149
152 Ga0123353_10137665 3300010167 Bacteria 3915
153 Ga0466690_283714 3300042590 Bacteria 7865
154 Ga0466693_293912 3300042592 Bacteria 55262
155 Ga0466691_053181 3300042593 Bacteria 12742
156 Ga0466691_117175 3300042593 Bacteria 17103
157 Ga0466691_183892 3300042593 Bacteria 6372
158 Ga0466696_355333 3300042596 Bacteria 15766
159 Ga0466700_193849 3300042600 Bacteria 35866
160 Ga0466713_149729 3300042602 Bacteria 4241
161 Ga0466716_036307 3300042605 Bacteria 12337
162 Ga0466722_180903 3300042609 Bacteria 6083
163 AustNasuHG_c1001397 3300000089 Bacteria 8649
164 JGI24695J34938_10002719 3300002450 Bacteria 13064
165 JGI24695J34938_10005691 3300002450 Bacteria 7692
166 Ga0466731_220686 3300042622 Bacteria 3869
167 Ga0466704_162661 3300042643 Bacteria 42824
168 Ga0466709_011335 3300042648 Bacteria 9665
169 Ga0466712_060898 3300042614 Bacteria 5491
170 Ga0466711_328337 3300042615 Bacteria 19036
171 Ga0466715_169362 3300042616 Bacteria 13308
172 Ga0466715_223087 3300042616 Bacteria 19089
173 Ga0466715_348500 3300042616 Bacteria 6756
174 Ga0466723_006530 3300042618 Bacteria 22703
175 Ga0123356_10000407 3300010049 Bacteria 48938
176 Ga0123356_10000431 3300010049 Bacteria 47938
177 Ga0123356_10039161 3300010049 Unclassified 4416
178 Ga0466691_015000 3300042593 Bacteria 23861
179 Ga0466694_050440 3300042594 Bacteria 148325
180 Ga0466694_083944 3300042594 Bacteria 13067
181 JGI24698J34947_10006188 3300002449 Bacteria 6574
182 JGI24695J34938_10000236 3300002450 Bacteria 52868
183 JGI24702J35022_10003723 3300002462 Bacteria 9166
184 Ga0466731_114944 3300042622 Bacteria 3913
185 Ga0466703_019276 3300042636 Bacteria 5538
186 Ga0466703_274929 3300042636 Bacteria 9941
187 Ga0466704_102062 3300042643 Bacteria 11274
188 Ga0466704_150528 3300042643 Bacteria 40163
189 Ga0466708_167746 3300042652 Bacteria 6730
190 Ga0466708_249234 3300042652 Bacteria 5870
191 Ga0466708_377629 3300042652 Bacteria 3510

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus 705 763 0.91
PF00204 DNA_gyraseB DNA gyrase B 394 533 0.89
PF01751 Toprim Toprim domain 567 674 0.83
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 208 338 0.78

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.