Protein Family IF10313

Metagenome Isolate
196 Members
126 Samples
116 Scaffolds
337.17 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_088459|Ga0466733_088459_10488_11579
Length
363 aa
Sequence
MSEALVHAGGGVRVDKQKGEIMAKMFYDDDADLSIIQNRKVAVIGYGSQGHAHALSLRDSGVDVRVGLRPGSASRDKAEAEGLRVVPTETACEEADLIMILAPDQVQRGLYAAEIAPHLKTGDALFFAHGFNIRFGYIQPPAGVDVCMVAPKGPGHLVRREYAAGRGVPVVVAVEKDESGAAWPLTLAYAKGIGGLRAGGIATTFTEETETDLFGEQAVLCGGMSHLIQAGWETLVNAGYQPEVAYFECLHEMKLIVDLMYEGGIAKQRWSVSDTAEYGDYVSGPRIIDDHVRESMKAVLADIQSGAFAARFIADQDAGAPEFKALRAKEEAHPIEATGRELRQLMSWVKTADSDYTEGTAAR

📊 Sample Types

Isolate 40.8%
Metagenome 59.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 25.8%
Termitidae 20.0%
Formicidae 9.2%
Anthocoridae 8.3%
Kalotermitidae 8.3%
Cambaridae 5.0%
Scarabaeidae 4.2%
Culicidae 2.5%
Tenebrionidae 2.5%
Armadillidiidae 1.7%
Rhinotermitidae 1.7%
Curculionidae 1.7%
Dytiscidae 1.7%
Termopsidae 1.7%
Hydrophilidae 1.7%
Apidae 0.8%
Chironomidae 0.8%
Pyralidae 0.8%
Thomisidae 0.8%
Hodotermitidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 192
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
2 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
3 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
4 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
5 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
6 2862784999 Streptomyces sp. M41 Isolate Unclassified
7 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
8 2931425734 Nocardioides sp. J2M5 Isolate
9 2931430189 Tessaracoccus palaemonis J1M15 Isolate
10 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
11 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
12 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
16 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
17 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
18 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
19 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
20 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
21 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
22 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
23 2896955351 Streptomyces sp. GF20 Isolate Termitidae
24 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
25 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
29 649989992 Pseudonocardia sp. P1 Isolate Formicidae
30 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
31 8073544309 Actinomadura sp. RB99 Isolate Termitidae
32 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
35 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
36 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
37 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
38 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
39 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
40 2912749649 Streptomyces sp. GS7 Isolate Termitidae
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
43 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
44 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
45 2820840446 Unclassified Actinobacteria Lab288P4bin17 Isolate Unclassified
46 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
47 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
48 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
49 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
50 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
51 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
52 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
53 3002678670 Agromyces sp. G127AT Isolate Unclassified
54 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
55 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
56 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
58 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
59 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
60 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
61 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
62 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
63 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
64 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
65 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
66 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
67 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
68 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
69 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
70 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
71 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
72 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
73 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
74 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
75 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
76 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
77 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
78 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
79 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
80 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
81 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
82 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
83 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
84 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
85 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
86 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
87 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
88 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
89 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
90 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
91 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
92 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
93 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
94 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
95 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
96 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
97 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
98 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
99 2547132081 Streptomyces sp. S4 Isolate Formicidae
100 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
101 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
102 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
103 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
104 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
105 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
106 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
107 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
108 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
109 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
110 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
111 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
112 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
113 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
114 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
115 2908241010 Streptomyces sp. HF10 Isolate Termitidae
116 2912817845 Streptomyces griseus SID164 Isolate
117 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
118 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
119 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
120 3006468911 Streptomyces sp. RB17 Isolate Termitidae
121 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
122 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
123 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
124 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
125 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
126 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10599587 3300010167 Bacteria 1575
2 Ga0466710_365453 3300042613 Bacteria 2064
3 Ga0160459_100664 3300012831 Bacteria 12004
4 Ga0466692_021036 3300042591 Bacteria 4408
5 Ga0466692_122739 3300042591 Bacteria 1326
6 Ga0466696_074647 3300042596 Bacteria 5834
7 Ga0466696_129064 3300042596 Bacteria 3714
8 Ga0466704_360510 3300042643 Bacteria 7834
9 Ga0466704_424257 3300042643 Bacteria 2427
10 Ga0466727_149972 3300042655 Bacteria 8441
11 Ga0466707_093680 3300042601 Bacteria 71749
12 Ga0123357_10000026 3300009784 Bacteria 128045
13 Ga0123357_10000037 3300009784 Bacteria 109871
14 Ga0123357_10000647 3300009784 Bacteria 34620
15 Ga0123357_10091579 3300009784 Bacteria 3959
16 Ga0123356_10000068 3300010049 Bacteria 108740
17 Ga0123356_10000676 3300010049 Bacteria 37752
18 Ga0466728_468570 3300042620 Bacteria 2585
19 Ga0160446_100323 3300012835 Bacteria 27155
20 Ga0466657_047195 3300042582 Bacteria 2098
21 Ga0466691_004808 3300042593 Bacteria 2645
22 Ga0466730_053908 3300042625 Bacteria 1515
23 Ga0466725_086751 3300042654 Bacteria 1458
24 Ga0466713_065581 3300042602 Bacteria 52137
25 Ga0466713_079531 3300042602 Bacteria 32951
26 JGI24699J35502_11099026 3300002509 Bacteria 2309
27 JGI24699J35502_11122476 3300002509 Bacteria 3440
28 Ga0123353_10000623 3300010167 Bacteria 43400
29 Ga0123353_10355624 3300010167 Bacteria 2204
30 Ga0123354_10261815 3300010882 Bacteria 1725
31 Ga0466723_128635 3300042618 Bacteria 45701
32 Ga0160460_101647 3300012845 Bacteria 6861
33 Ga0160433_104476 3300012846 Bacteria 2244
34 Ga0466693_148230 3300042592 Bacteria 38546
35 Ga0466730_063873 3300042625 Bacteria 6893
36 Ga0466703_349915 3300042636 Bacteria 3479
37 Ga0466725_017989 3300042654 Bacteria 1473
38 Ga0466706_007672 3300042599 Bacteria 1415
39 Ga0466706_152187 3300042599 Bacteria 12959
40 Ga0466713_090088 3300042602 Bacteria 4949
41 Ga0466713_099015 3300042602 Bacteria 104926
42 Ga0466733_016659 3300042659 Bacteria 19036
43 Ga0466733_088459 3300042659 Bacteria 38396
44 Ga0562378_0355 3300056814 Bacteria 89245
45 Ga0562375_5239 3300056856 Bacteria 8246
46 Ga0123357_10008501 3300009784 Bacteria 12838
47 Ga0123353_10678503 3300010167 Bacteria 1452
48 Ga0466723_349678 3300042618 Bacteria 2893
49 Ga0466726_167792 3300042619 Bacteria 3810
50 Ga0466729_039381 3300042621 Bacteria 1470
51 Ga0466730_093937 3300042625 Bacteria 26828
52 Ga0466703_403088 3300042636 Bacteria 1236
53 Ga0466704_074527 3300042643 Bacteria 5220
54 Ga0466704_215736 3300042643 Unclassified 30978
55 Ga0466708_207070 3300042652 Bacteria 4434
56 Ga0466713_115569 3300042602 Bacteria 9264
57 Ga0466698_310049 3300042610 Bacteria 2391
58 Ga0466697_269804 3300042611 Bacteria 1699
59 Ga0123354_10048845 3300010882 Bacteria 6425
60 Ga0466705_455057 3300042612 Bacteria 8149
61 Ga0466710_147804 3300042613 Bacteria 1366
62 Ga0466712_036137 3300042614 Bacteria 1590
63 Ga0466723_054120 3300042618 Bacteria 26199
64 Ga0466723_198703 3300042618 Bacteria 8878
65 Ga0466723_330279 3300042618 Bacteria 8986
66 Ga0160459_101162 3300012831 Unclassified 6844
67 Ga0466734_039779 3300042623 Bacteria 1796
68 Ga0466703_081658 3300042636 Bacteria 26167
69 Ga0466713_075165 3300042602 Bacteria 11919
70 Ga0466719_349854 3300042606 Bacteria 27287
71 Ga0466719_522042 3300042606 Bacteria 3922
72 Ga0123356_10007105 3300010049 Bacteria 11215
73 Ga0123356_10028704 3300010049 Bacteria 5212
74 Ga0123353_10483118 3300010167 Unclassified 1812
75 Ga0123354_10007651 3300010882 Bacteria 16311
76 Ga0466715_020843 3300042616 Bacteria 77878
77 Ga0466723_147233 3300042618 Bacteria 6176
78 Ga0160455_102546 3300012837 Bacteria 3669
79 Ga0466691_073277 3300042593 Bacteria 11125
80 Ga0466703_238713 3300042636 Bacteria 47888
81 Ga0466700_137486 3300042600 Bacteria 5854
82 Ga0466707_273399 3300042601 Bacteria 64548
83 JGI24705J35276_12221159 3300002504 Bacteria 2319
84 Ga0466705_003036 3300042612 Bacteria 5920
85 Ga0466733_199171 3300042659 Bacteria 58555
86 Ga0562376_3663 3300056857 Bacteria 14911
87 Ga0123357_10038044 3300009784 Bacteria 6551
88 Ga0123356_10003864 3300010049 Bacteria 15608
89 Ga0466715_059738 3300042616 Bacteria 13741
90 Ga0160432_102495 3300012818 Bacteria 3847
91 Ga0160430_101833 3300012852 Bacteria 7368
92 Ga0466704_395985 3300042643 Bacteria 4741
93 Ga0466724_08127 3300042649 Bacteria 26680
94 Ga0466727_208222 3300042655 Bacteria 3805
95 Ga0466706_166351 3300042599 Bacteria 10416
96 Ga0466706_228217 3300042599 Bacteria 67941
97 Ga0466713_001026 3300042602 Bacteria 36059
98 JGI24699J35502_11118827 3300002509 Unclassified 3122
99 Ga0072941_1037045 3300005201 Bacteria 16013
100 Ga0123357_10000950 3300009784 Bacteria 29496
101 Ga0466705_132655 3300042612 Bacteria 5536
102 Ga0562378_0075 3300056814 Bacteria 280321
103 Ga0562375_2359 3300056856 Bacteria 21367
104 Ga0562376_0018 3300056857 Bacteria 481690
105 Ga0123357_10014281 3300009784 Bacteria 10357
106 Ga0123356_10000416 3300010049 Bacteria 48609
107 Ga0466705_394808 3300042612 Bacteria 5372
108 Ga0466728_314377 3300042620 Bacteria 6403
109 Ga0466696_001102 3300042596 Bacteria 5376
110 Ga0466696_320963 3300042596 Bacteria 13939
111 Ga0466725_358960 3300042654 Bacteria 3878
112 Ga0466706_244626 3300042599 Bacteria 1203
113 Ga0466713_050983 3300042602 Bacteria 10911
114 Ga0466713_070278 3300042602 Bacteria 3529
115 Ga0466713_137650 3300042602 Bacteria 20025
116 JGI24699J35502_11133769 3300002509 Bacteria 15200

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain 205 348 1
PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain 36 199 0.99
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 40 105 0.85
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 31 111 0.79

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02826 GO:0051287 NAD binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.