Protein Family IF10312
Metagenome
Isolate
166
Members
90
Samples
125
Scaffolds
338.83
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_087265|Ga0466733_087265_7698_8693
- Length
- 331 aa
- Sequence
- MIKRAKDGVYAYPAINVTSSQTLNAALAGFAEAGSDGIVQVSTGGAEYASGPTIKNMVTGAVALAEYAHVVAKNYPVNIALHTDHCPKDKLAGYVRPLLAISAERVKAGKDPLFGSHMWDGSALDNTTENLAIAEELLKLTKANHQILEIEIGAVGGEEDGVVGEINEKLYSTVAMGMQTVETLGLGEQGLYMTALTFGNVHGVYKPGHVKLRPEVLKQIQDAVGQKYGVDKPFSLVFHGGSGSSAQEISDAVDYGVIKMNIDTDTQYAFTRPVVDFMFKGYDGVLKIDGEVGNKKQYDPRAWGKVAEAGLAARVVEAAKELRSAGKHFDA
Sample Types
Isolate
24.7%
Metagenome
75.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.2%
Termitidae
25.0%
Kalotermitidae
11.9%
Scarabaeidae
7.1%
Culicidae
6.0%
Cambaridae
4.8%
Armadillidiidae
3.6%
Termopsidae
3.6%
Hydrophilidae
2.4%
Rhinotermitidae
2.4%
Pyralidae
1.2%
Tenebrionidae
1.2%
Thomisidae
1.2%
Hodotermitidae
1.2%
Apidae
1.2%
Cerambycidae
1.2%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 2 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 5 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 6 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 7 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 8 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 9 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 10 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 11 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 12 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 13 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 19 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 20 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 21 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 22 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 23 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 24 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 25 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 37 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 38 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 39 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 40 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 41 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 42 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 43 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 47 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 51 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 52 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 53 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 54 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 55 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 56 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 57 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 61 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 62 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 63 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 64 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 65 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 66 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 67 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 68 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 69 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 70 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 71 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 72 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 73 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 74 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 75 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 76 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 77 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 78 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 79 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 80 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 81 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 82 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 83 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 84 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 85 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 86 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 87 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 88 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 89 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 90 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160448_110186 | 3300012854 | Bacteria | 2000 |
| 2 | Ga0160457_1000012 | 3300012858 | Bacteria | 443154 |
| 3 | Ga0466693_056620 | 3300042592 | Bacteria | 145249 |
| 4 | Ga0466729_245601 | 3300042621 | Bacteria | 1952 |
| 5 | Ga0466703_166237 | 3300042636 | Bacteria | 199031 |
| 6 | Ga0466703_384330 | 3300042636 | Bacteria | 5598 |
| 7 | Ga0466704_288839 | 3300042643 | Bacteria | 36613 |
| 8 | Ga0466707_377241 | 3300042601 | Bacteria | 85191 |
| 9 | Ga0466714_013557 | 3300042603 | Bacteria | 1063 |
| 10 | Ga0466723_000899 | 3300042618 | Bacteria | 8957 |
| 11 | Ga0466729_110168 | 3300042621 | Bacteria | 1652 |
| 12 | Ga0160431_101420 | 3300012828 | Unclassified | 6904 |
| 13 | Ga0160459_100020 | 3300012831 | Bacteria | 369522 |
| 14 | Ga0160447_102020 | 3300012849 | Bacteria | 7434 |
| 15 | Ga0160434_100004 | 3300012850 | Bacteria | 458481 |
| 16 | Ga0466734_008072 | 3300042623 | Bacteria | 1613 |
| 17 | Ga0466730_062778 | 3300042625 | Bacteria | 8633 |
| 18 | Ga0123357_10086039 | 3300009784 | Unclassified | 4114 |
| 19 | Ga0123356_10103974 | 3300010049 | Bacteria | 2729 |
| 20 | Ga0123354_10053201 | 3300010882 | Bacteria | 6090 |
| 21 | Ga0123354_10113236 | 3300010882 | Unclassified | 3565 |
| 22 | Ga0466706_163016 | 3300042599 | Bacteria | 1223 |
| 23 | Ga0466707_183224 | 3300042601 | Bacteria | 7691 |
| 24 | Ga0466713_097188 | 3300042602 | Bacteria | 20787 |
| 25 | Ga0466713_137680 | 3300042602 | Bacteria | 2485 |
| 26 | Ga0466713_140791 | 3300042602 | Bacteria | 3527 |
| 27 | JGI24705J35276_12224669 | 3300002504 | Bacteria | 2635 |
| 28 | JGI24699J35502_10954484 | 3300002509 | Unclassified | 1184 |
| 29 | Ga0123357_10000168 | 3300009784 | Unclassified | 59832 |
| 30 | Ga0466705_447151 | 3300042612 | Unclassified | 6756 |
| 31 | Ga0466733_144465 | 3300042659 | Bacteria | 21475 |
| 32 | Ga0466696_178898 | 3300042596 | Bacteria | 3039 |
| 33 | Ga0466696_501988 | 3300042596 | Bacteria | 6658 |
| 34 | Ga0466703_213744 | 3300042636 | Bacteria | 3946 |
| 35 | Ga0466724_28572 | 3300042649 | Bacteria | 30322 |
| 36 | Ga0466708_142458 | 3300042652 | Bacteria | 3034 |
| 37 | Ga0466708_259725 | 3300042652 | Bacteria | 2519 |
| 38 | Ga0466727_182723 | 3300042655 | Bacteria | 3907 |
| 39 | Ga0123357_10004537 | 3300009784 | Bacteria | 16335 |
| 40 | Ga0123356_10001946 | 3300010049 | Unclassified | 22367 |
| 41 | Ga0123353_10582663 | 3300010167 | Bacteria | 1604 |
| 42 | Ga0466706_154978 | 3300042599 | Bacteria | 125008 |
| 43 | Ga0466706_260706 | 3300042599 | Bacteria | 4679 |
| 44 | Ga0466707_129448 | 3300042601 | Bacteria | 2958 |
| 45 | Ga0466713_146315 | 3300042602 | Bacteria | 33798 |
| 46 | Ga0466719_056955 | 3300042606 | Bacteria | 41698 |
| 47 | JGI24699J35502_11133231 | 3300002509 | Bacteria | 9331 |
| 48 | Ga0068302_10436935 | 3300005071 | Bacteria | 2146 |
| 49 | Ga0123357_10000103 | 3300009784 | Bacteria | 70483 |
| 50 | Ga0466715_254603 | 3300042616 | Bacteria | 1720 |
| 51 | Ga0466696_281224 | 3300042596 | Bacteria | 5189 |
| 52 | Ga0466734_163509 | 3300042623 | Bacteria | 1608 |
| 53 | Ga0466703_081732 | 3300042636 | Bacteria | 90481 |
| 54 | Ga0466704_271014 | 3300042643 | Bacteria | 8282 |
| 55 | Ga0123357_10035547 | 3300009784 | Bacteria | 6773 |
| 56 | Ga0123353_10004971 | 3300010167 | Bacteria | 17318 |
| 57 | Ga0123353_10471240 | 3300010167 | Bacteria | 1841 |
| 58 | Ga0123354_10006692 | 3300010882 | Bacteria | 17178 |
| 59 | Ga0160442_100108 | 3300012806 | Bacteria | 94453 |
| 60 | Ga0466717_053437 | 3300042604 | Unclassified | 5729 |
| 61 | JGI24703J35330_11649168 | 3300002501 | Bacteria | 1588 |
| 62 | Ga0466715_239315 | 3300042616 | Bacteria | 37773 |
| 63 | Ga0466705_083825 | 3300042612 | Unclassified | 1818 |
| 64 | Ga0466733_020692 | 3300042659 | Bacteria | 1592 |
| 65 | Ga0160447_104639 | 3300012849 | Unclassified | 4018 |
| 66 | Ga0466657_191984 | 3300042582 | Bacteria | 1427 |
| 67 | Ga0466692_000884 | 3300042591 | Bacteria | 1859 |
| 68 | Ga0466696_362427 | 3300042596 | Bacteria | 1326 |
| 69 | Ga0466703_185155 | 3300042636 | Bacteria | 1601 |
| 70 | Ga0466704_456319 | 3300042643 | Bacteria | 1710 |
| 71 | Ga0466727_290179 | 3300042655 | Bacteria | 2011 |
| 72 | Ga0123357_10238917 | 3300009784 | Unclassified | 1972 |
| 73 | Ga0123353_10017872 | 3300010167 | Unclassified | 10453 |
| 74 | Ga0123353_10477134 | 3300010167 | Unclassified | 1826 |
| 75 | Ga0160466_100834 | 3300012809 | Unclassified | 11642 |
| 76 | Ga0466713_072347 | 3300042602 | Bacteria | 39759 |
| 77 | Ga0466713_135511 | 3300042602 | Bacteria | 3745 |
| 78 | Ga0466717_127044 | 3300042604 | Unclassified | 3457 |
| 79 | Ga0466705_387755 | 3300042612 | Bacteria | 5357 |
| 80 | Ga0466715_133497 | 3300042616 | Bacteria | 2981 |
| 81 | Ga0466726_494245 | 3300042619 | Bacteria | 2131 |
| 82 | Ga0466729_096008 | 3300042621 | Bacteria | 14163 |
| 83 | Ga0466733_087265 | 3300042659 | Bacteria | 208960 |
| 84 | Ga0466696_342625 | 3300042596 | Bacteria | 17848 |
| 85 | Ga0466704_037541 | 3300042643 | Bacteria | 9264 |
| 86 | Ga0123356_10000556 | 3300010049 | Bacteria | 41420 |
| 87 | Ga0123356_10004882 | 3300010049 | Unclassified | 13776 |
| 88 | Ga0466713_052629 | 3300042602 | Bacteria | 187952 |
| 89 | Ga0466713_134721 | 3300042602 | Bacteria | 13347 |
| 90 | JGI24699J35502_11130783 | 3300002509 | Unclassified | 5282 |
| 91 | Ga0123357_10001415 | 3300009784 | Bacteria | 25412 |
| 92 | Ga0123357_10002669 | 3300009784 | Bacteria | 20074 |
| 93 | Ga0466715_394054 | 3300042616 | Bacteria | 4252 |
| 94 | Ga0466723_062421 | 3300042618 | Bacteria | 5257 |
| 95 | Ga0466723_336148 | 3300042618 | Bacteria | 3530 |
| 96 | Ga0466728_298281 | 3300042620 | Bacteria | 2006 |
| 97 | Ga0466705_336564 | 3300042612 | Bacteria | 10670 |
| 98 | Ga0160456_100835 | 3300012820 | Bacteria | 8350 |
| 99 | Ga0160452_100009 | 3300012834 | Bacteria | 407346 |
| 100 | Ga0160455_100882 | 3300012837 | Bacteria | 11372 |
| 101 | Ga0466703_047883 | 3300042636 | Bacteria | 1576 |
| 102 | Ga0466704_279079 | 3300042643 | Bacteria | 7272 |
| 103 | Ga0466704_472717 | 3300042643 | Bacteria | 5845 |
| 104 | Ga0466724_64100 | 3300042649 | Bacteria | 707103 |
| 105 | Ga0466727_147781 | 3300042655 | Bacteria | 25772 |
| 106 | Ga0123354_10055444 | 3300010882 | Bacteria | 5931 |
| 107 | Ga0160464_101949 | 3300012805 | Unclassified | 4827 |
| 108 | Ga0466707_253520 | 3300042601 | Bacteria | 1210 |
| 109 | Ga0466713_074689 | 3300042602 | Bacteria | 17137 |
| 110 | Ga0466698_359858 | 3300042610 | Bacteria | 1962 |
| 111 | Ga0466723_209909 | 3300042618 | Bacteria | 24747 |
| 112 | Ga0466691_154544 | 3300042593 | Bacteria | 6081 |
| 113 | Ga0466703_165690 | 3300042636 | Unclassified | 18969 |
| 114 | Ga0466703_266902 | 3300042636 | Bacteria | 19337 |
| 115 | Ga0466704_225963 | 3300042643 | Bacteria | 60445 |
| 116 | Ga0466725_376925 | 3300042654 | Bacteria | 3058 |
| 117 | Ga0123357_10095613 | 3300009784 | Bacteria | 3851 |
| 118 | Ga0123356_10000796 | 3300010049 | Bacteria | 34989 |
| 119 | Ga0123354_10409902 | 3300010882 | Bacteria | 1138 |
| 120 | Ga0466706_068509 | 3300042599 | Bacteria | 10737 |
| 121 | Ga0466700_400179 | 3300042600 | Bacteria | 35717 |
| 122 | Ga0466719_344645 | 3300042606 | Bacteria | 18840 |
| 123 | Ga0466705_478645 | 3300042612 | Bacteria | 47544 |
| 124 | Ga0466718_114826 | 3300042617 | Bacteria | 4356 |
| 125 | Ga0466723_080772 | 3300042618 | Bacteria | 15502 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01116 | F_bP_aldolase | Fructose-bisphosphate aldolase class-II | 1 | 327 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.