Protein Family IF10301

Metagenome Isolate
148 Members
54 Samples
128 Scaffolds
312.07 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_070581|Ga0466733_070581_4358_5398
Length
346 aa
Sequence
MRRSWLKYVNSGVFFRHLLFLPLKYEFNKFNKVKTKMKRRDFIKTGVAAGAALTLNFDGLQAALKSNNMVVEQVPDMVAVMGGEPEAMLDKALEELGGIGKFIKKGQKVVIKPNIGWDRKPELAANTNPGLVKALIKKCLDAGAEKVTVFDQTCDNWQRCYDNSGIAAAAKEAGAIVMPANEEKYFREVTIPNGVILKKAKIHEALVEADAWINMPILKNHGGAKLSCAMKNYMGIVWDRRFFHSNDLQQCIADICTWEKKPVLNIVDAYRIMHQNGPQGKSAADVATIKSLIASPNIIAVDTAALGMFNQVKKLDIAAVTHLGKGESLNLGSTDLKKINIKRVRM

📊 Sample Types

Isolate 13.5%
Metagenome 86.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 35.8%
Kalotermitidae 26.4%
Termitidae 17.0%
Unclassified 7.5%
Passalidae 5.7%
Rhinotermitidae 3.8%
Termopsidae 3.8%

🌳 Taxonomy

Archaea 2
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
2 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
3 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 2923982719 Parabacteroides sp. 52 Isolate Blattidae
13 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
14 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
15 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
22 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
23 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
24 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
25 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
33 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
34 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
36 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
37 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
38 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
39 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
40 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
41 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
42 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
45 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
46 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
47 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
48 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
49 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
50 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
51 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
52 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
53 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
54 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_325816 3300042612 Unclassified 8680
2 Ga0466733_008528 3300042659 Bacteria 2399
3 Ga0466733_070581 3300042659 Bacteria 40188
4 Ga0466707_041894 3300042601 Bacteria 3554
5 Ga0466713_067986 3300042602 Bacteria 4362
6 Ga0466719_343973 3300042606 Bacteria 2054
7 2227131093 2225789004 Unclassified 1660
8 Ga0466704_266903 3300042643 Bacteria 41558
9 Ga0466709_129537 3300042648 Bacteria 3023
10 Ga0466727_083279 3300042655 Bacteria 5020
11 Ga0466727_219718 3300042655 Bacteria 37959
12 Ga0466727_327235 3300042655 Bacteria 2558
13 Ga0466711_277914 3300042615 Bacteria 30814
14 Ga0466728_415375 3300042620 Bacteria 16610
15 Ga0466733_113177 3300042659 Bacteria 40710
16 Ga0123354_10014977 3300010882 Bacteria 12086
17 Ga0466690_246295 3300042590 Unclassified 2969
18 Ga0466690_344545 3300042590 Bacteria 20962
19 Ga0466696_207603 3300042596 Bacteria 8687
20 Ga0466696_253210 3300042596 Bacteria 201850
21 Ga0466696_253221 3300042596 Bacteria 1237
22 Ga0466713_143605 3300042602 Bacteria 4813
23 Ga0466719_553058 3300042606 Bacteria 14131
24 JGI24702J35022_10004215 3300002462 Unclassified 8586
25 Ga0072941_1404414 3300005201 Bacteria 2243
26 Ga0466703_267528 3300042636 Bacteria 11437
27 Ga0466709_070368 3300042648 Bacteria 3430
28 Ga0466709_345321 3300042648 Bacteria 16276
29 Ga0466708_099520 3300042652 Bacteria 3018
30 Ga0466715_138418 3300042616 Bacteria 28149
31 Ga0466715_284898 3300042616 Bacteria 18837
32 Ga0466705_164285 3300042612 Unclassified 1129
33 Ga0123357_10035419 3300009784 Bacteria 6786
34 Ga0466690_045334 3300042590 Bacteria 11475
35 Ga0466696_192998 3300042596 Bacteria 8888
36 Ga0466696_492998 3300042596 Bacteria 11047
37 Ga0466696_493255 3300042596 Bacteria 6560
38 Ga0466707_007887 3300042601 Bacteria 2116
39 Ga0466713_115337 3300042602 Bacteria 64305
40 Ga0466719_233836 3300042606 Bacteria 4229
41 Ga0466719_484373 3300042606 Bacteria 5427
42 Ga0466722_146634 3300042609 Bacteria 6827
43 IMNBL1DRAFT_c0000713 3300000062 Bacteria 26512
44 Ga0466703_148080 3300042636 Bacteria 3916
45 Ga0466727_115846 3300042655 Bacteria 8491
46 Ga0466715_320122 3300042616 Bacteria 8709
47 Ga0466715_563767 3300042616 Bacteria 24196
48 Ga0466726_344322 3300042619 Bacteria 3164
49 Ga0466728_131636 3300042620 Bacteria 2113
50 Ga0466728_218686 3300042620 Bacteria 4809
51 Ga0466705_126183 3300042612 Bacteria 3488
52 Ga0466733_120112 3300042659 Bacteria 197910
53 Ga0466690_393445 3300042590 Bacteria 25549
54 Ga0466691_093818 3300042593 Unclassified 1622
55 Ga0466713_035097 3300042602 Bacteria 3720
56 Ga0466719_245504 3300042606 Bacteria 8163
57 Ga0466722_148343 3300042609 Bacteria 9523
58 Ga0068305_10080837 3300005083 Bacteria 4334
59 Ga0068305_10110809 3300005083 Bacteria 18257
60 Ga0466729_273653 3300042621 Archaea 2463
61 Ga0466704_032095 3300042643 Bacteria 1052
62 Ga0466727_110672 3300042655 Bacteria 2037
63 Ga0466727_178354 3300042655 Bacteria 10201
64 Ga0466727_254056 3300042655 Bacteria 3439
65 Ga0466711_019964 3300042615 Bacteria 4618
66 Ga0466715_143523 3300042616 Bacteria 2564
67 Ga0466726_000993 3300042619 Bacteria 7440
68 Ga0466732_207286 3300042656 Bacteria 11616
69 Ga0466690_123196 3300042590 Bacteria 6940
70 Ga0466690_180916 3300042590 Bacteria 5118
71 Ga0466716_009253 3300042605 Bacteria 2324
72 Ga0466716_417458 3300042605 Bacteria 20964
73 2227075224 2225789003 Bacteria 11325
74 2227571857 2225789004 Bacteria 13830
75 IMNBL1DRAFT_c0000468 3300000062 Bacteria 33779
76 Ga0466704_007745 3300042643 Unclassified 1559
77 Ga0466704_146857 3300042643 Bacteria 17615
78 Ga0466704_247727 3300042643 Bacteria 2686
79 Ga0466704_270760 3300042643 Bacteria 29721
80 Ga0466725_284162 3300042654 Bacteria 9060
81 Ga0466727_049674 3300042655 Bacteria 3148
82 Ga0466726_325054 3300042619 Bacteria 2461
83 Ga0466690_172624 3300042590 Bacteria 11627
84 Ga0466707_183401 3300042601 Bacteria 17213
85 Ga0466707_351567 3300042601 Bacteria 1187
86 Ga0466716_114211 3300042605 Bacteria 30877
87 Ga0466716_249040 3300042605 Bacteria 9709
88 Ga0466703_088036 3300042636 Unclassified 12760
89 Ga0466703_097689 3300042636 Bacteria 37276
90 Ga0466703_336099 3300042636 Bacteria 22653
91 Ga0466727_196200 3300042655 Bacteria 12184
92 Ga0466711_002120 3300042615 Bacteria 20160
93 Ga0466711_010079 3300042615 Bacteria 1292
94 Ga0466726_012021 3300042619 Bacteria 19051
95 Ga0466726_167458 3300042619 Unclassified 2833
96 Ga0466705_102184 3300042612 Bacteria 2460
97 Ga0466733_136620 3300042659 Bacteria 3049
98 Ga0466691_203112 3300042593 Bacteria 2891
99 Ga0466696_093668 3300042596 Bacteria 7745
100 Ga0466696_281250 3300042596 Bacteria 3332
101 Ga0466707_352060 3300042601 Bacteria 5193
102 IMNBL1DRAFT_c0000444 3300000062 Bacteria 34756
103 Ga0068305_10009986 3300005083 Bacteria 12441
104 Ga0466704_253595 3300042643 Unclassified 2820
105 Ga0466704_280705 3300042643 Bacteria 11568
106 Ga0466709_128894 3300042648 Bacteria 25011
107 Ga0466711_000845 3300042615 Bacteria 8985
108 Ga0466711_485581 3300042615 Archaea 7989
109 Ga0466723_020739 3300042618 Bacteria 9278
110 Ga0466723_038195 3300042618 Bacteria 30632
111 Ga0466723_127056 3300042618 Bacteria 25983
112 Ga0466705_029464 3300042612 Bacteria 4892
113 Ga0123354_10218845 3300010882 Bacteria 2031
114 Ga0466690_092197 3300042590 Bacteria 28749
115 Ga0466693_262490 3300042592 Bacteria 2212
116 Ga0466696_393396 3300042596 Bacteria 4777
117 Ga0466713_065086 3300042602 Bacteria 42766
118 Ga0466713_152881 3300042602 Bacteria 22181
119 Ga0466697_008737 3300042611 Bacteria 1212
120 2227474635 2225789004 Bacteria 22751
121 JGI24696J40584_12950884 3300002834 Bacteria 2188
122 Ga0466703_072985 3300042636 Bacteria 12798
123 Ga0466704_137475 3300042643 Bacteria 11012
124 Ga0466708_080542 3300042652 Bacteria 14093
125 Ga0466705_400119 3300042612 Bacteria 34089
126 Ga0466711_420572 3300042615 Unclassified 4603
127 Ga0466715_150783 3300042616 Bacteria 2305
128 Ga0466715_521826 3300042616 Bacteria 60910

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_246295 Ga0466690_246295_30_839 269
2 3300042619 Ga0466726_167458 Ga0466726_167458_1588_2517 289
3 3300042593 Ga0466691_093818 Ga0466691_093818_333_1262 290
4 3300042619 Ga0466726_012021 Ga0466726_012021_7452_8381 290
5 2225789004 2227131093 2227528235 291
6 3300042655 Ga0466727_110672 Ga0466727_110672_594_1523 292
7 3300005083 Ga0068305_10110809 Ga0068305_1011080919 296
8 3300042596 Ga0466696_393396 Ga0466696_393396_1813_2754 297
9 3300042611 Ga0466697_008737 Ga0466697_008737_27_920 297
10 3300042643 Ga0466704_032095 Ga0466704_032095_123_1022 299
11 3300042615 Ga0466711_010079 Ga0466711_010079_71_1006 300
12 3300042590 Ga0466690_344545 Ga0466690_344545_3502_4425 307
13 3300042609 Ga0466722_148343 Ga0466722_148343_4091_5014 307
14 3300042590 Ga0466690_045334 Ga0466690_045334_8592_9521 309
15 3300042596 Ga0466696_207603 Ga0466696_207603_5916_6845 309
16 3300042602 Ga0466713_035097 Ga0466713_035097_2598_3527 309
17 3300042602 Ga0466713_065086 Ga0466713_065086_17619_18548 309
18 3300042602 Ga0466713_152881 Ga0466713_152881_21050_21979 309
19 3300042605 Ga0466716_009253 Ga0466716_009253_775_1704 309
20 3300042605 Ga0466716_114211 Ga0466716_114211_23365_24294 309
21 3300042621 Ga0466729_273653 Ga0466729_273653_1019_1948 309
22 3300042656 Ga0466732_207286 Ga0466732_207286_4862_5791 309
23 2225789003 2227075224 2227439993 310
24 2225789004 2227474635 2227925213 310
25 3300009784 Ga0123357_10035419 Ga0123357_100354193 310
26 3300010882 Ga0123354_10014977 Ga0123354_100149777 310
27 3300010882 Ga0123354_10218845 Ga0123354_102188452 310
28 3300042590 Ga0466690_092197 Ga0466690_092197_5664_6596 310
29 3300042590 Ga0466690_123196 Ga0466690_123196_5707_6639 310
30 3300042593 Ga0466691_203112 Ga0466691_203112_1046_1978 310
31 3300042596 Ga0466696_253210 Ga0466696_253210_137136_138068 310
32 3300042606 Ga0466719_245504 Ga0466719_245504_5621_6553 310
33 3300042612 Ga0466705_164285 Ga0466705_164285_108_1040 310
34 3300042615 Ga0466711_000845 Ga0466711_000845_5988_6920 310
35 3300042615 Ga0466711_019964 Ga0466711_019964_1578_2510 310
36 3300042615 Ga0466711_420572 Ga0466711_420572_3463_4395 310
37 3300042616 Ga0466715_284898 Ga0466715_284898_11053_11985 310
38 3300042616 Ga0466715_521826 Ga0466715_521826_6017_6949 310
39 3300042616 Ga0466715_563767 Ga0466715_563767_15899_16831 310
40 3300042618 Ga0466723_020739 Ga0466723_020739_2104_3036 310
41 3300042620 Ga0466728_131636 Ga0466728_131636_608_1540 310
42 3300042620 Ga0466728_415375 Ga0466728_415375_6180_7112 310
43 3300042636 Ga0466703_072985 Ga0466703_072985_6449_7381 310
44 3300042636 Ga0466703_097689 Ga0466703_097689_20700_21632 310
45 3300042643 Ga0466704_007745 Ga0466704_007745_195_1127 310
46 3300042643 Ga0466704_146857 Ga0466704_146857_14977_15909 310
47 3300042643 Ga0466704_270760 Ga0466704_270760_19157_20089 310
48 3300042643 Ga0466704_280705 Ga0466704_280705_7087_8019 310
49 3300042648 Ga0466709_070368 Ga0466709_070368_2432_3364 310
50 3300042648 Ga0466709_129537 Ga0466709_129537_389_1321 310
51 3300042659 Ga0466733_008528 Ga0466733_008528_1125_2057 310
52 iso_pr_bacteria 2923982719 2923983600 310
53 iso_pr_bacteria 2940195863 2940196829 310
54 iso_pr_bacteria 2940199050 2940199104 310
55 iso_pr_bacteria 2940202316 2940202662 310
56 iso_pr_bacteria 2940205530 2940206485 310
57 iso_pr_bacteria 2940209341 2940210244 310
58 iso_pr_bacteria 2940212447 2940213241 310
59 iso_pr_bacteria 2940298504 2940299455 310
60 iso_pr_bacteria 2940302308 2940303102 310
61 iso_pr_bacteria 2940306115 2940306984 310
62 iso_pr_bacteria 2940309933 2940310801 310
63 iso_pr_bacteria 2940313741 2940314484 310
64 iso_pr_bacteria 2940317558 2940318298 310
65 iso_pr_bacteria 2940321370 2940322111 310
66 iso_pr_bacteria 2940325180 2940325974 310
67 iso_pr_bacteria 2940328985 2940329939 310
68 iso_pr_bacteria 2940332795 2940333664 310
69 iso_pr_bacteria 2940346213 2940346568 310
70 iso_pr_bacteria 2940371297 2940371531 310
71 3300000062 IMNBL1DRAFT_c0000444 IMNBL1DRAFT_000044425 311
72 3300000062 IMNBL1DRAFT_c0000713 IMNBL1DRAFT_00007139 311
73 3300042609 Ga0466722_146634 Ga0466722_146634_1794_2729 311
74 3300042655 Ga0466727_178354 Ga0466727_178354_7652_8587 311
75 3300042659 Ga0466733_120112 Ga0466733_120112_117020_117955 311
76 3300042619 Ga0466726_000993 Ga0466726_000993_3523_4461 312
77 3300042655 Ga0466727_254056 Ga0466727_254056_967_1905 312
78 iso_pr_bacteria 2740892545 2743906557 312
79 2225789004 2227571857 2228117555 313
80 3300000062 IMNBL1DRAFT_c0000468 IMNBL1DRAFT_000046815 313
81 3300005083 Ga0068305_10080837 Ga0068305_100808372 313
82 3300005201 Ga0072941_1404414 Ga0072941_14044142 313
83 3300042590 Ga0466690_172624 Ga0466690_172624_3379_4320 313
84 3300042592 Ga0466693_262490 Ga0466693_262490_941_1882 313
85 3300042596 Ga0466696_253221 Ga0466696_253221_99_1040 313
86 3300042596 Ga0466696_281250 Ga0466696_281250_1962_2903 313
87 3300042596 Ga0466696_492998 Ga0466696_492998_4976_5917 313
88 3300042596 Ga0466696_493255 Ga0466696_493255_1657_2598 313
89 3300042601 Ga0466707_007887 Ga0466707_007887_298_1239 313
90 3300042601 Ga0466707_041894 Ga0466707_041894_743_1684 313
91 3300042602 Ga0466713_067986 Ga0466713_067986_3162_4103 313
92 3300042602 Ga0466713_115337 Ga0466713_115337_53696_54637 313
93 3300042602 Ga0466713_143605 Ga0466713_143605_3803_4744 313
94 3300042605 Ga0466716_249040 Ga0466716_249040_2180_3121 313
95 3300042605 Ga0466716_417458 Ga0466716_417458_9093_10034 313
96 3300042606 Ga0466719_343973 Ga0466719_343973_807_1748 313
97 3300042606 Ga0466719_484373 Ga0466719_484373_2739_3680 313
98 3300042606 Ga0466719_553058 Ga0466719_553058_4388_5329 313
99 3300042612 Ga0466705_029464 Ga0466705_029464_1978_2919 313
100 3300042612 Ga0466705_126183 Ga0466705_126183_1186_2127 313
101 3300042612 Ga0466705_325816 Ga0466705_325816_381_1322 313
102 3300042615 Ga0466711_002120 Ga0466711_002120_9188_10129 313
103 3300042615 Ga0466711_277914 Ga0466711_277914_959_1900 313
104 3300042616 Ga0466715_138418 Ga0466715_138418_15271_16212 313
105 3300042616 Ga0466715_150783 Ga0466715_150783_871_1812 313
106 3300042616 Ga0466715_320122 Ga0466715_320122_1036_1977 313
107 3300042618 Ga0466723_038195 Ga0466723_038195_27686_28627 313
108 3300042618 Ga0466723_127056 Ga0466723_127056_7403_8344 313
109 3300042619 Ga0466726_325054 Ga0466726_325054_426_1367 313
110 3300042619 Ga0466726_344322 Ga0466726_344322_462_1403 313
111 3300042620 Ga0466728_218686 Ga0466728_218686_2132_3073 313
112 3300042636 Ga0466703_148080 Ga0466703_148080_411_1352 313
113 3300042636 Ga0466703_267528 Ga0466703_267528_8080_9021 313
114 3300042643 Ga0466704_137475 Ga0466704_137475_4126_5067 313
115 3300042643 Ga0466704_266903 Ga0466704_266903_21645_22586 313
116 3300042648 Ga0466709_128894 Ga0466709_128894_15836_16777 313
117 3300042652 Ga0466708_080542 Ga0466708_080542_3634_4575 313
118 3300042655 Ga0466727_049674 Ga0466727_049674_1866_2807 313
119 3300042655 Ga0466727_115846 Ga0466727_115846_1406_2347 313
120 3300042655 Ga0466727_196200 Ga0466727_196200_4289_5230 313
121 3300042655 Ga0466727_219718 Ga0466727_219718_28657_29598 313
122 3300042655 Ga0466727_327235 Ga0466727_327235_261_1202 313
123 3300002462 JGI24702J35022_10004215 JGI24702J35022_100042152 314
124 3300002834 JGI24696J40584_12950884 JGI24696J40584_129508842 314
125 3300005083 Ga0068305_10009986 Ga0068305_100099867 314
126 3300042654 Ga0466725_284162 Ga0466725_284162_2313_3257 314
127 3300042659 Ga0466733_136620 Ga0466733_136620_321_1310 314
128 3300042601 Ga0466707_183401 Ga0466707_183401_5955_6902 315
129 3300042612 Ga0466705_102184 Ga0466705_102184_233_1183 316
130 3300042636 Ga0466703_088036 Ga0466703_088036_356_1306 316
131 3300042643 Ga0466704_247727 Ga0466704_247727_1371_2321 316
132 3300042643 Ga0466704_253595 Ga0466704_253595_393_1343 316
133 3300042606 Ga0466719_233836 Ga0466719_233836_1273_2226 317
134 3300042616 Ga0466715_143523 Ga0466715_143523_836_1789 317
135 3300042652 Ga0466708_099520 Ga0466708_099520_66_1025 319
136 3300042596 Ga0466696_093668 Ga0466696_093668_2000_2962 320
137 3300042596 Ga0466696_192998 Ga0466696_192998_2173_3135 320
138 3300042590 Ga0466690_393445 Ga0466690_393445_23007_23972 321
139 3300042612 Ga0466705_400119 Ga0466705_400119_17165_18130 321
140 3300042636 Ga0466703_336099 Ga0466703_336099_17481_18446 321
141 3300042615 Ga0466711_485581 Ga0466711_485581_6749_7717 322
142 3300042601 Ga0466707_352060 Ga0466707_352060_2096_3079 327
143 3300042655 Ga0466727_083279 Ga0466727_083279_327_1316 329
144 3300042590 Ga0466690_180916 Ga0466690_180916_539_1531 330
145 3300042601 Ga0466707_351567 Ga0466707_351567_44_1042 332
146 3300042659 Ga0466733_113177 Ga0466733_113177_1633_2637 334
147 3300042659 Ga0466733_070581 Ga0466733_070581_4358_5398 346
148 3300042648 Ga0466709_345321 Ga0466709_345321_161_1402 413

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04015 DUF362 Domain of unknown function (DUF362) 109 306 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.