Protein Family IF10277
Metagenome
Isolate
131
Members
69
Samples
115
Scaffolds
280.32
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_025888|Ga0466733_025888_15782_16705
- Length
- 307 aa
- Sequence
- MPEVCRNHVELKGLTRIISVKTALSVMEKENWTTVIKPKTGLLEVGFKELIDYKDLCVMFVKRDIVTLYKQTILGPLWFIINPILTTAMYMVVFGGIAGISTDGLPQPLFYLAGICLWNYFSTCLTKTSTTFVTNQAIFGKVYFPRLVMPLSISISSLVTLGIQFLLFVAVYAYYIMQGVSIAPNIYILLVPVLIAMLAGLSLGFGIITSSLTTKYRDLSILFTFAVQLWMYATPIIYPLGTMPPKTQWVMALNPVTSIIETFKYATLGQGVFSWAQLGYSFAFTCAVLGIGIVIFNRVQRSFMDTV
Sample Types
Isolate
12.2%
Metagenome
87.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.4%
Kalotermitidae
19.4%
Unclassified
11.9%
Blattidae
7.5%
Formicidae
6.0%
Elmidae
4.5%
Passalidae
4.5%
Termopsidae
4.5%
Drosophilidae
3.0%
Culicidae
3.0%
Rhinotermitidae
3.0%
Armadillidiidae
1.5%
Hydrophilidae
1.5%
Daphniidae
1.5%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 2 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 8 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 9 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 24 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 29 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 30 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 31 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 34 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 35 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 41 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 42 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 43 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 48 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 49 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 56 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 57 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 58 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 59 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 60 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 61 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 62 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 63 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 64 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 65 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 66 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 67 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 69 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_025888 | 3300042659 | Bacteria | 28930 |
| 2 | Ga0466733_040584 | 3300042659 | Bacteria | 5524 |
| 3 | Ga0466733_221827 | 3300042659 | Bacteria | 7647 |
| 4 | Ga0466705_433289 | 3300042612 | Bacteria | 1566 |
| 5 | Ga0466731_056111 | 3300042622 | Bacteria | 1129 |
| 6 | Ga0466735_119871 | 3300042624 | Unclassified | 1774 |
| 7 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 8 | Ga0466703_192467 | 3300042636 | Bacteria | 4197 |
| 9 | Ga0466704_081521 | 3300042643 | Bacteria | 7559 |
| 10 | Ga0160444_100090 | 3300012841 | Bacteria | 116868 |
| 11 | Ga0466694_256167 | 3300042594 | Unclassified | 25111 |
| 12 | Ga0466707_032562 | 3300042601 | Bacteria | 2512 |
| 13 | Ga0466707_159375 | 3300042601 | Bacteria | 13999 |
| 14 | Ga0466713_043123 | 3300042602 | Bacteria | 81226 |
| 15 | Ga0466716_127599 | 3300042605 | Bacteria | 5815 |
| 16 | Ga0466719_193024 | 3300042606 | Bacteria | 1108 |
| 17 | AustNasuHG_c1001857 | 3300000089 | Bacteria | 7638 |
| 18 | JGI24705J35276_12238610 | 3300002504 | Bacteria | 29496 |
| 19 | Ga0068305_10729399 | 3300005083 | Bacteria | 2331 |
| 20 | Ga0102736_1000151 | 3300007052 | Bacteria | 41405 |
| 21 | Ga0466711_039051 | 3300042615 | Bacteria | 2205 |
| 22 | Ga0466715_135674 | 3300042616 | Bacteria | 34654 |
| 23 | Ga0466723_203856 | 3300042618 | Bacteria | 2111 |
| 24 | Ga0466726_354312 | 3300042619 | Bacteria | 12493 |
| 25 | Ga0466703_286969 | 3300042636 | Bacteria | 2153 |
| 26 | Ga0466703_298915 | 3300042636 | Bacteria | 1885 |
| 27 | Ga0466704_417045 | 3300042643 | Bacteria | 12166 |
| 28 | Ga0466708_115899 | 3300042652 | Bacteria | 5291 |
| 29 | Ga0466690_255712 | 3300042590 | Bacteria | 5068 |
| 30 | Ga0466692_034223 | 3300042591 | Bacteria | 54843 |
| 31 | Ga0466707_039903 | 3300042601 | Bacteria | 24387 |
| 32 | Ga0466707_348521 | 3300042601 | Bacteria | 1328 |
| 33 | Ga0466714_068450 | 3300042603 | Bacteria | 45601 |
| 34 | 2227491886 | 2225789004 | Bacteria | 4058 |
| 35 | IMNBGM34_c004555 | 3300000036 | Bacteria | 1872 |
| 36 | JGI24695J34938_10000900 | 3300002450 | Bacteria | 27462 |
| 37 | Ga0466711_250155 | 3300042615 | Bacteria | 8285 |
| 38 | Ga0466729_311623 | 3300042621 | Bacteria | 3457 |
| 39 | Ga0466735_091533 | 3300042624 | Bacteria | 22096 |
| 40 | Ga0123354_10013939 | 3300010882 | Bacteria | 12502 |
| 41 | Ga0123354_10163887 | 3300010882 | Bacteria | 2623 |
| 42 | Ga0160446_100122 | 3300012835 | Bacteria | 69003 |
| 43 | Ga0466690_259901 | 3300042590 | Bacteria | 5140 |
| 44 | Ga0466701_017684 | 3300042598 | Bacteria | 2820 |
| 45 | Ga0466707_359800 | 3300042601 | Bacteria | 1790 |
| 46 | IMNBL1DRAFT_c0000261 | 3300000062 | Bacteria | 46561 |
| 47 | Ga0103264_1000104 | 3300007188 | Bacteria | 49090 |
| 48 | Ga0466715_030834 | 3300042616 | Bacteria | 5286 |
| 49 | Ga0466715_139815 | 3300042616 | Bacteria | 3274 |
| 50 | Ga0466715_249034 | 3300042616 | Bacteria | 10571 |
| 51 | Ga0466728_355816 | 3300042620 | Unclassified | 1552 |
| 52 | Ga0466734_071349 | 3300042623 | Bacteria | 3716 |
| 53 | Ga0123353_10443040 | 3300010167 | Bacteria | 1915 |
| 54 | Ga0123353_10448870 | 3300010167 | Bacteria | 1899 |
| 55 | Ga0123354_10004397 | 3300010882 | Bacteria | 19955 |
| 56 | Ga0466657_234309 | 3300042582 | Bacteria | 2261 |
| 57 | Ga0466690_300520 | 3300042590 | Bacteria | 6112 |
| 58 | Ga0466696_425887 | 3300042596 | Unclassified | 1650 |
| 59 | Ga0466700_131815 | 3300042600 | Bacteria | 50718 |
| 60 | 2227523538 | 2225789004 | Bacteria | 3289 |
| 61 | JGI24705J35276_12222202 | 3300002504 | Bacteria | 2401 |
| 62 | Ga0072941_1733763 | 3300005201 | Bacteria | 1490 |
| 63 | Ga0103265_1000005 | 3300007068 | Bacteria | 101135 |
| 64 | Ga0104045_1000716 | 3300007085 | Unclassified | 3439 |
| 65 | Ga0466705_169650 | 3300042612 | Unclassified | 10255 |
| 66 | Ga0466712_053332 | 3300042614 | Unclassified | 3848 |
| 67 | Ga0466709_130933 | 3300042648 | Bacteria | 4326 |
| 68 | Ga0123353_10111010 | 3300010167 | Bacteria | 4417 |
| 69 | Ga0123353_10551567 | 3300010167 | Bacteria | 1662 |
| 70 | Ga0123353_11074420 | 3300010167 | Bacteria | 1072 |
| 71 | Ga0123354_10112882 | 3300010882 | Unclassified | 3574 |
| 72 | Ga0466692_074053 | 3300042591 | Bacteria | 15653 |
| 73 | Ga0466701_086124 | 3300042598 | Bacteria | 60334 |
| 74 | 2227358575 | 2225789004 | Bacteria | 27923 |
| 75 | Ga0466726_294202 | 3300042619 | Bacteria | 1932 |
| 76 | Ga0466731_414863 | 3300042622 | Bacteria | 1367 |
| 77 | Ga0466704_041737 | 3300042643 | Bacteria | 9602 |
| 78 | Ga0466709_417477 | 3300042648 | Bacteria | 4199 |
| 79 | Ga0123356_10004830 | 3300010049 | Bacteria | 13868 |
| 80 | Ga0123354_10006259 | 3300010882 | Bacteria | 17634 |
| 81 | Ga0123354_10085257 | 3300010882 | Bacteria | 4427 |
| 82 | Ga0466694_170886 | 3300042594 | Bacteria | 2171 |
| 83 | Ga0466707_296253 | 3300042601 | Bacteria | 25031 |
| 84 | Ga0466716_159224 | 3300042605 | Bacteria | 6131 |
| 85 | Ga0466719_253408 | 3300042606 | Bacteria | 2643 |
| 86 | 2227419997 | 2225789004 | Bacteria | 1049 |
| 87 | 2227638502 | 2225789004 | Bacteria | 11121 |
| 88 | IMNBL1DRAFT_c0000469 | 3300000062 | Bacteria | 33711 |
| 89 | Ga0123357_10000423 | 3300009784 | Bacteria | 40429 |
| 90 | Ga0466733_044535 | 3300042659 | Bacteria | 127501 |
| 91 | Ga0466728_380615 | 3300042620 | Bacteria | 1268 |
| 92 | Ga0466735_088782 | 3300042624 | Bacteria | 1456 |
| 93 | Ga0466724_37932 | 3300042649 | Bacteria | 325221 |
| 94 | Ga0466708_184325 | 3300042652 | Bacteria | 14364 |
| 95 | Ga0466727_188985 | 3300042655 | Unclassified | 3338 |
| 96 | Ga0123353_10701629 | 3300010167 | Bacteria | 1420 |
| 97 | Ga0160472_100233 | 3300012839 | Bacteria | 66227 |
| 98 | Ga0160472_100566 | 3300012839 | Bacteria | 21941 |
| 99 | Ga0466690_193388 | 3300042590 | Bacteria | 1086 |
| 100 | Ga0466696_284154 | 3300042596 | Bacteria | 2334 |
| 101 | Ga0466701_022354 | 3300042598 | Bacteria | 90611 |
| 102 | Ga0466707_089123 | 3300042601 | Bacteria | 18294 |
| 103 | Ga0104050_1001326 | 3300007153 | Bacteria | 4248 |
| 104 | Ga0103267_1000818 | 3300007190 | Bacteria | 8110 |
| 105 | Ga0466711_299966 | 3300042615 | Bacteria | 14644 |
| 106 | Ga0466735_059303 | 3300042624 | Bacteria | 1726 |
| 107 | Ga0466704_063898 | 3300042643 | Bacteria | 1424 |
| 108 | Ga0466727_323834 | 3300042655 | Unclassified | 1491 |
| 109 | Ga0123357_10133021 | 3300009784 | Bacteria | 3087 |
| 110 | Ga0123357_10184619 | 3300009784 | Unclassified | 2424 |
| 111 | Ga0123353_10001066 | 3300010167 | Unclassified | 33504 |
| 112 | Ga0466707_174317 | 3300042601 | Bacteria | 5323 |
| 113 | IMNBGM34_c000232 | 3300000036 | Bacteria | 16190 |
| 114 | JGI24699J35502_11134167 | 3300002509 | Bacteria | 43250 |
| 115 | Ga0123357_10001166 | 3300009784 | Bacteria | 27443 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01061 | ABC2_membrane | ABC-2 type transporter | 58 | 265 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.