Protein Family IF10268
Metagenome
Isolate
133
Members
56
Samples
117
Scaffolds
373.8
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_004128|Ga0466733_004128_700_1836
- Length
- 378 aa
- Sequence
- MGVTITGVATKADRLKFVKFPINLYKNNPYYVPAFVLDELATLDPKKNPAFEFCEAKLFLAYSGKQVVGRIAAIINHRSNEIWNQKQARFGFVDFIDDNEVVDALFGAAEDWVQSMGMEAVHGPLGFTDLDREGLLIEGFDKLGTMVTLYCHPYYQTQIERIGYRKDTDWNEFLIQVPDNIPERHQRIAKIVADKYGLKVLKFNSKKEIEPYIDQIFELLNKAYKPLYGYVELSKKQIDYYVKTFISLLRWEIVPVIVKEDTNQVIAFGIAAPSLSKALQASRGKLFPFGWIGLLKALKSKNNPIIDLMIIGIDPEYQGKGINAMVFADMISSAYKCGFRYAESNPELETNNKMSSLWDGFVAENHKKRRAYIKKLKN
Sample Types
Isolate
12.0%
Metagenome
88.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.5%
Kalotermitidae
25.5%
Blattidae
21.8%
Unclassified
12.7%
Rhinotermitidae
5.5%
Termopsidae
5.5%
Passalidae
3.6%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 3 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 4 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 20 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 21 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 22 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 23 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 43 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 47 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 48 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 49 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 50 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 52 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 53 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 54 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 55 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_064536 | 3300042611 | Bacteria | 2693 |
| 2 | Ga0466715_180732 | 3300042616 | Bacteria | 9421 |
| 3 | Ga0466726_003419 | 3300042619 | Bacteria | 66294 |
| 4 | Ga0466726_289602 | 3300042619 | Bacteria | 3781 |
| 5 | Ga0466728_453051 | 3300042620 | Bacteria | 4299 |
| 6 | Ga0466713_035811 | 3300042602 | Bacteria | 2857 |
| 7 | Ga0466722_135732 | 3300042609 | Bacteria | 9416 |
| 8 | IMNBL1DRAFT_c0002641 | 3300000062 | Bacteria | 12271 |
| 9 | Ga0123357_10000953 | 3300009784 | Bacteria | 29426 |
| 10 | Ga0466657_332437 | 3300042582 | Bacteria | 1507 |
| 11 | Ga0466690_002563 | 3300042590 | Bacteria | 35514 |
| 12 | Ga0466690_103040 | 3300042590 | Bacteria | 7271 |
| 13 | Ga0466692_119633 | 3300042591 | Bacteria | 108688 |
| 14 | Ga0466735_106251 | 3300042624 | Bacteria | 7054 |
| 15 | Ga0466735_115300 | 3300042624 | Bacteria | 3947 |
| 16 | Ga0466703_019192 | 3300042636 | Bacteria | 3031 |
| 17 | Ga0466703_030789 | 3300042636 | Bacteria | 16264 |
| 18 | Ga0466703_131622 | 3300042636 | Bacteria | 3569 |
| 19 | Ga0466704_080743 | 3300042643 | Bacteria | 31033 |
| 20 | Ga0466704_145968 | 3300042643 | Bacteria | 20472 |
| 21 | Ga0466707_416976 | 3300042601 | Bacteria | 13390 |
| 22 | Ga0466713_012777 | 3300042602 | Unclassified | 21574 |
| 23 | Ga0466713_077113 | 3300042602 | Bacteria | 10235 |
| 24 | Ga0466719_139427 | 3300042606 | Bacteria | 18554 |
| 25 | Ga0123353_10232070 | 3300010167 | Bacteria | 2876 |
| 26 | Ga0123354_10015660 | 3300010882 | Bacteria | 11858 |
| 27 | Ga0123354_10132834 | 3300010882 | Bacteria | 3133 |
| 28 | Ga0072941_1049923 | 3300005201 | Bacteria | 2115 |
| 29 | Ga0466692_129839 | 3300042591 | Bacteria | 6251 |
| 30 | Ga0466691_078604 | 3300042593 | Bacteria | 17200 |
| 31 | Ga0466733_013509 | 3300042659 | Bacteria | 8665 |
| 32 | Ga0466715_084050 | 3300042616 | Bacteria | 7152 |
| 33 | Ga0466715_320776 | 3300042616 | Bacteria | 30358 |
| 34 | Ga0466735_044827 | 3300042624 | Bacteria | 4545 |
| 35 | Ga0466713_058914 | 3300042602 | Bacteria | 10168 |
| 36 | Ga0466713_093032 | 3300042602 | Bacteria | 12374 |
| 37 | Ga0466719_061695 | 3300042606 | Bacteria | 12823 |
| 38 | Ga0466719_082759 | 3300042606 | Bacteria | 6619 |
| 39 | Ga0466719_335142 | 3300042606 | Bacteria | 2270 |
| 40 | Ga0123353_10544036 | 3300010167 | Bacteria | 1677 |
| 41 | IMNBL1DRAFT_c0001181 | 3300000062 | Bacteria | 19912 |
| 42 | JGI24699J35502_11134024 | 3300002509 | Bacteria | 24835 |
| 43 | JGI24699J35502_11134105 | 3300002509 | Bacteria | 31307 |
| 44 | JGI24696J40584_12935923 | 3300002834 | Bacteria | 1570 |
| 45 | Ga0068305_10047015 | 3300005083 | Bacteria | 10541 |
| 46 | Ga0466692_011810 | 3300042591 | Bacteria | 3809 |
| 47 | Ga0466696_062776 | 3300042596 | Bacteria | 9759 |
| 48 | Ga0466705_386231 | 3300042612 | Bacteria | 4421 |
| 49 | Ga0466733_037360 | 3300042659 | Bacteria | 17049 |
| 50 | Ga0466715_024383 | 3300042616 | Bacteria | 26866 |
| 51 | Ga0466723_090046 | 3300042618 | Bacteria | 10526 |
| 52 | Ga0466735_150621 | 3300042624 | Bacteria | 1746 |
| 53 | Ga0466703_220516 | 3300042636 | Bacteria | 13924 |
| 54 | Ga0466727_269194 | 3300042655 | Bacteria | 5070 |
| 55 | Ga0466700_080920 | 3300042600 | Bacteria | 34770 |
| 56 | Ga0466707_383222 | 3300042601 | Bacteria | 43346 |
| 57 | Ga0466716_016748 | 3300042605 | Bacteria | 11880 |
| 58 | Ga0466716_215607 | 3300042605 | Bacteria | 12242 |
| 59 | Ga0123353_10350504 | 3300010167 | Bacteria | 2225 |
| 60 | Ga0123354_10099086 | 3300010882 | Unclassified | 3958 |
| 61 | Ga0466733_004128 | 3300042659 | Bacteria | 2640 |
| 62 | Ga0466735_156239 | 3300042624 | Bacteria | 11962 |
| 63 | Ga0466704_135835 | 3300042643 | Bacteria | 5881 |
| 64 | Ga0466704_210281 | 3300042643 | Bacteria | 12955 |
| 65 | Ga0466704_378393 | 3300042643 | Bacteria | 6759 |
| 66 | Ga0466709_368924 | 3300042648 | Bacteria | 2972 |
| 67 | Ga0466708_251448 | 3300042652 | Bacteria | 5773 |
| 68 | Ga0466713_107438 | 3300042602 | Bacteria | 2913 |
| 69 | Ga0466714_163409 | 3300042603 | Bacteria | 1550 |
| 70 | Ga0466719_378878 | 3300042606 | Bacteria | 3929 |
| 71 | Ga0466722_019633 | 3300042609 | Bacteria | 1369 |
| 72 | Ga0466722_030300 | 3300042609 | Bacteria | 1369 |
| 73 | Ga0466722_175484 | 3300042609 | Bacteria | 16031 |
| 74 | Ga0123357_10082708 | 3300009784 | Bacteria | 4215 |
| 75 | Ga0123356_10006051 | 3300010049 | Bacteria | 12274 |
| 76 | Ga0123354_10161258 | 3300010882 | Bacteria | 2661 |
| 77 | Ga0466703_025159 | 3300042636 | Bacteria | 24490 |
| 78 | Ga0466703_317173 | 3300042636 | Unclassified | 7389 |
| 79 | Ga0466704_236373 | 3300042643 | Bacteria | 11089 |
| 80 | Ga0466709_076850 | 3300042648 | Bacteria | 50213 |
| 81 | Ga0466707_242090 | 3300042601 | Bacteria | 13004 |
| 82 | Ga0466713_017110 | 3300042602 | Unclassified | 1969 |
| 83 | Ga0466713_095333 | 3300042602 | Bacteria | 7204 |
| 84 | Ga0466722_169662 | 3300042609 | Bacteria | 9082 |
| 85 | IMNBL1DRAFT_c0010049 | 3300000062 | Bacteria | 4586 |
| 86 | JGI24699J35502_11134139 | 3300002509 | Bacteria | 36268 |
| 87 | Ga0123357_10001881 | 3300009784 | Bacteria | 22798 |
| 88 | Ga0466715_084192 | 3300042616 | Bacteria | 39268 |
| 89 | Ga0466715_212319 | 3300042616 | Bacteria | 50715 |
| 90 | Ga0466735_074110 | 3300042624 | Bacteria | 2589 |
| 91 | Ga0466735_100892 | 3300042624 | Bacteria | 12211 |
| 92 | Ga0466735_165799 | 3300042624 | Bacteria | 4589 |
| 93 | Ga0466730_058138 | 3300042625 | Bacteria | 2126 |
| 94 | Ga0466704_140354 | 3300042643 | Bacteria | 3176 |
| 95 | Ga0466727_314523 | 3300042655 | Bacteria | 8017 |
| 96 | Ga0466701_038531 | 3300042598 | Bacteria | 8654 |
| 97 | Ga0466700_465756 | 3300042600 | Bacteria | 3352 |
| 98 | Ga0466707_398517 | 3300042601 | Bacteria | 7240 |
| 99 | Ga0466713_095879 | 3300042602 | Bacteria | 2771 |
| 100 | Ga0466719_372844 | 3300042606 | Bacteria | 7253 |
| 101 | Ga0123354_10005674 | 3300010882 | Bacteria | 18247 |
| 102 | Ga0123354_10019958 | 3300010882 | Bacteria | 10532 |
| 103 | Ga0466690_118484 | 3300042590 | Bacteria | 2640 |
| 104 | Ga0466705_108394 | 3300042612 | Bacteria | 3845 |
| 105 | Ga0466711_042192 | 3300042615 | Bacteria | 7319 |
| 106 | Ga0466728_297447 | 3300042620 | Unclassified | 2559 |
| 107 | Ga0466729_232386 | 3300042621 | Bacteria | 1165 |
| 108 | Ga0466703_033655 | 3300042636 | Bacteria | 4013 |
| 109 | Ga0466727_037894 | 3300042655 | Bacteria | 109077 |
| 110 | Ga0466700_020224 | 3300042600 | Bacteria | 23800 |
| 111 | Ga0466707_094727 | 3300042601 | Bacteria | 1569 |
| 112 | Ga0466707_389970 | 3300042601 | Bacteria | 7998 |
| 113 | Ga0466713_124022 | 3300042602 | Bacteria | 3332 |
| 114 | 2227524630 | 2225789004 | Bacteria | 16931 |
| 115 | JGI24702J35022_10023546 | 3300002462 | Bacteria | 3329 |
| 116 | Ga0123357_10000449 | 3300009784 | Bacteria | 39751 |
| 117 | Ga0466692_107418 | 3300042591 | Bacteria | 14127 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.