Protein Family IF10244

Metagenome Isolate
173 Members
109 Samples
99 Scaffolds
367.9 Avg Length

🧬 Representative Sequence

ID
3300042656|Ga0466732_168047|Ga0466732_168047_253_1455
Length
400 aa
Sequence
MKPLSARAEHKRMYEFIPDNPYLLLTPGPLSTSKGVRNAMLRDWCTWDTDYNEKIVQNIRCRLSALASARPEDYTAVLMQGSGSFAVEAVLGTALPLDGKLLIIANGAYGKRMVQIARVLKLNCIEYCLSETEAPQPETVSKILLDNPGVTHTAMVHCETTTGMLNPLAEISRAVKERGAIFILDAMSSFGGIPLAMEDYGIDFLISSSNKCIQGVPGFAFVIAKRETLQKCRGNARSLCLDLYDQWKEMDQTGKWRYTSPTHAVRAFYQALDELEAEGGVISRNRRYCENQRLLVEGMSALGFQPLLPRNLQSPIITSFLYPRTEYAAGPASAGDGSPPAFDFTSFYQAVKKQGFVLYPGKISQADTFRIGNIGEVYPHDIKKLLDVIGNVMASGQFSF

📊 Sample Types

Isolate 42.8%
Metagenome 57.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 56.9%
Termitidae 13.7%
Kalotermitidae 12.7%
Talitridae 2.9%
Blattidae 2.0%
Rhinotermitidae 2.0%
Majidae 2.0%
Elmidae 1.0%
Penaeidae 1.0%
Termopsidae 1.0%
Palinuridae 1.0%
Nephropidae 1.0%
Artemiidae 1.0%
Drosophilidae 1.0%
Culicidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 168
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
2 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
3 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
4 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
5 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
6 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
7 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
8 2684622551 Vibrio campbellii E1 Isolate Unclassified
9 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
10 2820215626 Unclassified Kiritimatiellaeota Nt197P3bin123 Isolate Unclassified
11 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
12 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
13 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
14 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
15 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
16 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
17 8022096067 Vibrio sp. SALL6 Isolate Unclassified
18 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
19 8051461712 Vibrio vulnificus Vv002 Isolate
20 8060845732 Vibrio vulnificus Vv006 Isolate
21 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
28 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
29 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
32 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 2511231129 Vibrio sp. EJY3 Isolate Unclassified
37 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
38 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
39 2820214248 Unclassified Kiritimatiellaeota Nt197P3bin16 Isolate Unclassified
40 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
41 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
42 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
43 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
44 2908136803 Vibrio owensii 1700302 Isolate Unclassified
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
47 640963010 Vibrio harveyi HY01 Isolate Unclassified
48 8022345672 Vibrio sp. 070316B Isolate Unclassified
49 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
50 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
51 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
52 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
53 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
54 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
55 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
56 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
57 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
58 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
59 2850895757 Vibrio campbellii 170502 Isolate Unclassified
60 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
61 2872471378 Vibrio owensii V180403 Isolate Unclassified
62 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
63 8022087107 Vibrio sp. OULL4 Isolate Unclassified
64 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
65 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
66 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
67 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
68 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
69 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
70 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
71 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
72 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
73 2554235022 Vibrio parahaemolyticus v110 Isolate
74 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
75 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
76 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
77 2820924633 Unclassified Actinobacteria Emb289P3bin142 Isolate Unclassified
78 2912570088 Vibrio parahaemolyticus CHN25 Isolate
79 8051551332 Vibrio vulnificus Vv003 Isolate
80 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
81 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
82 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
83 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
84 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
85 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
86 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
87 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
88 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
89 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
90 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
91 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
92 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
93 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
94 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
95 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
96 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
97 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
98 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
99 2791355473 Vibrio barjaei 3062 Isolate Unclassified
100 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
101 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
102 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
103 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
104 8051534459 Vibrio vulnificus Vv004 Isolate
105 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
106 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
107 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
108 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
109 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10169482 3300009826 Bacteria 3267
2 Ga0123353_10221729 3300010167 Bacteria 2956
3 Ga0466728_337764 3300042620 Bacteria 49516
4 Ga0466699_100197 3300042597 Bacteria 2485
5 Ga0466713_145818 3300042602 Bacteria 4861
6 Ga0466716_390594 3300042605 Bacteria 4889
7 Ga0466698_101656 3300042610 Bacteria 2286
8 Ga0068305_10568946 3300005083 Bacteria 1345
9 Ga0466703_039529 3300042636 Bacteria 19304
10 Ga0466703_162812 3300042636 Bacteria 83208
11 Ga0466709_012558 3300042648 Bacteria 7918
12 Ga0123355_10253076 3300009826 Bacteria 2476
13 Ga0123356_10240172 3300010049 Bacteria 1882
14 Ga0466705_390090 3300042612 Bacteria 3608
15 Ga0466711_041848 3300042615 Bacteria 64215
16 Ga0466711_472366 3300042615 Bacteria 2673
17 Ga0466718_010060 3300042617 Bacteria 10028
18 Ga0466718_126393 3300042617 Bacteria 4524
19 Ga0466723_100293 3300042618 Bacteria 7098
20 Ga0466693_284398 3300042592 Bacteria 1654
21 Ga0466693_303549 3300042592 Bacteria 1868
22 Ga0466696_277589 3300042596 Bacteria 2967
23 Ga0466719_127827 3300042606 Bacteria 5149
24 JGI24695J34938_10034557 3300002450 Bacteria 2319
25 Ga0466703_067792 3300042636 Bacteria 28120
26 Ga0466708_041937 3300042652 Bacteria 9701
27 Ga0123355_10012401 3300009826 Bacteria 13198
28 Ga0123353_10174872 3300010167 Bacteria 3405
29 Ga0466718_127753 3300042617 Bacteria 6639
30 Ga0415639_040632 3300038395 Unclassified 1224
31 Ga0466693_157510 3300042592 Bacteria 2270
32 Ga0466694_084550 3300042594 Bacteria 4228
33 Ga0466713_102734 3300042602 Bacteria 10870
34 Ga0466713_104495 3300042602 Bacteria 37503
35 Ga0466705_381340 3300042612 Bacteria 29177
36 Ga0466732_168047 3300042656 Bacteria 8893
37 Ga0123356_10065729 3300010049 Bacteria 3394
38 Ga0466711_305198 3300042615 Bacteria 4259
39 Ga0466723_306361 3300042618 Bacteria 3602
40 Ga0466723_341041 3300042618 Bacteria 1737
41 Ga0466728_309822 3300042620 Bacteria 4634
42 Ga0264413_105108 3300024493 Bacteria 14581
43 Ga0466690_121890 3300042590 Bacteria 4595
44 Ga0466692_028981 3300042591 Bacteria 12946
45 Ga0466691_083997 3300042593 Bacteria 3708
46 Ga0466716_205033 3300042605 Bacteria 7013
47 Ga0466698_516643 3300042610 Unclassified 4009
48 JGI24695J34938_10000728 3300002450 Bacteria 31017
49 JGI24695J34938_10035079 3300002450 Bacteria 2297
50 Ga0466705_055628 3300042612 Bacteria 3590
51 Ga0466705_093658 3300042612 Bacteria 8152
52 Ga0466709_286952 3300042648 Bacteria 4043
53 Ga0466727_013447 3300042655 Bacteria 1573
54 Ga0123355_10027570 3300009826 Bacteria 9174
55 Ga0123356_10353889 3300010049 Bacteria 1593
56 Ga0123356_10671800 3300010049 Bacteria 1204
57 Ga0123353_10025962 3300010167 Bacteria 8936
58 Ga0466711_511555 3300042615 Bacteria 26685
59 Ga0415639_121310 3300038395 Bacteria 3667
60 Ga0466692_067944 3300042591 Bacteria 1953
61 Ga0466691_211389 3300042593 Bacteria 1890
62 Ga0466694_177723 3300042594 Bacteria 1866
63 Ga0072940_1029148 3300005200 Unclassified 9527
64 Ga0123355_10001104 3300009826 Bacteria 37286
65 Ga0123353_10123955 3300010167 Bacteria 4153
66 Ga0466715_009140 3300042616 Bacteria 6834
67 Ga0415639_087173 3300038395 Bacteria 3043
68 Ga0466696_134355 3300042596 Bacteria 5170
69 AustNasuHG_c1000613 3300000089 Bacteria 12595
70 Ga0466703_088937 3300042636 Bacteria 4850
71 Ga0466708_292277 3300042652 Bacteria 30652
72 Ga0123355_10602559 3300009826 Bacteria 1303
73 Ga0123356_10001761 3300010049 Bacteria 23598
74 Ga0123353_10005951 3300010167 Bacteria 16137
75 Ga0123353_10112348 3300010167 Bacteria 4387
76 Ga0466715_426733 3300042616 Bacteria 2335
77 Ga0466692_197914 3300042591 Bacteria 18924
78 Ga0466693_235060 3300042592 Bacteria 141148
79 Ga0466707_129002 3300042601 Bacteria 12899
80 Ga0466719_011265 3300042606 Bacteria 2872
81 Ga0466722_065288 3300042609 Bacteria 10466
82 Ga0466722_261322 3300042609 Bacteria 2346
83 JGI24695J34938_10004920 3300002450 Unclassified 8538
84 Ga0466708_199946 3300042652 Bacteria 2272
85 Ga0466732_417157 3300042656 Bacteria 5943
86 Ga0123356_10051092 3300010049 Bacteria 3846
87 Ga0466711_162623 3300042615 Bacteria 17214
88 Ga0466711_276563 3300042615 Bacteria 6016
89 Ga0160435_1009019 3300012857 Bacteria 2129
90 Ga0466692_157833 3300042591 Bacteria 70790
91 Ga0466693_270716 3300042592 Bacteria 1505
92 Ga0466691_170816 3300042593 Bacteria 23653
93 Ga0466707_237092 3300042601 Bacteria 3181
94 Ga0466719_280721 3300042606 Bacteria 4680
95 Ga0466720_097324 3300042607 Bacteria 31013
96 Ga0072940_1000998 3300005200 Unclassified 12733
97 Ga0072940_1000999 3300005200 Bacteria 18030
98 Ga0072940_1003479 3300005200 Bacteria 9609
99 Ga0072940_1018082 3300005200 Bacteria 14766

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00266 Aminotran_5 Aminotransferase class-V 54 307 0.85

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.