Protein Family IF10237
Metagenome
Isolate
114
Members
45
Samples
109
Scaffolds
102.62
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_117160|Ga0466732_117160_268_612
- Length
- 114 aa
- Sequence
- MKFSERLKELWDQGLAVSKDFAVKTGGKAQELGERGVLLLEIKQLEGQAQKLVNRLGNEAYKAFAEQGIETVSAESAPIKGILEEIALIKDSIEKKDAELQSKKNGKTQEKKEE
Sample Types
Isolate
4.4%
Metagenome
95.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.2%
Kalotermitidae
25.6%
Unclassified
14.0%
Rhinotermitidae
9.3%
Termopsidae
7.0%
Taxonomy
Archaea
1
Bacteria
102
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 12 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 13 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_047926 | 3300042659 | Bacteria | 1122 |
| 2 | Ga0466735_088136 | 3300042624 | Bacteria | 1568 |
| 3 | Ga0466709_317691 | 3300042648 | Bacteria | 3087 |
| 4 | Ga0466720_233601 | 3300042607 | Bacteria | 1227 |
| 5 | Ga0123357_10420091 | 3300009784 | Archaea | 1194 |
| 6 | Ga0466696_058093 | 3300042596 | Bacteria | 7089 |
| 7 | Ga0466696_167801 | 3300042596 | Bacteria | 10223 |
| 8 | Ga0466696_303494 | 3300042596 | Bacteria | 2153 |
| 9 | Ga0466699_228150 | 3300042597 | Bacteria | 1702 |
| 10 | JGI24698J34947_10013371 | 3300002449 | Bacteria | 4482 |
| 11 | JGI24698J34947_10024656 | 3300002449 | Bacteria | 3210 |
| 12 | Ga0072941_1084510 | 3300005201 | Bacteria | 1319 |
| 13 | Ga0072941_1514287 | 3300005201 | Bacteria | 750 |
| 14 | Ga0466712_254865 | 3300042614 | Bacteria | 5143 |
| 15 | Ga0466715_247632 | 3300042616 | Bacteria | 1192 |
| 16 | Ga0466718_064760 | 3300042617 | Bacteria | 5588 |
| 17 | Ga0466718_083324 | 3300042617 | Bacteria | 1435 |
| 18 | Ga0466723_361531 | 3300042618 | Bacteria | 4558 |
| 19 | Ga0466705_143552 | 3300042612 | Bacteria | 39742 |
| 20 | Ga0466705_270893 | 3300042612 | Bacteria | 5644 |
| 21 | Ga0466732_320112 | 3300042656 | Bacteria | 3620 |
| 22 | Ga0466719_369466 | 3300042606 | Bacteria | 7198 |
| 23 | Ga0466719_373322 | 3300042606 | Unclassified | 7239 |
| 24 | Ga0466698_374694 | 3300042610 | Bacteria | 5118 |
| 25 | Ga0123357_10013843 | 3300009784 | Unclassified | 10495 |
| 26 | Ga0123356_11465909 | 3300010049 | Bacteria | 841 |
| 27 | Ga0123354_10561565 | 3300010882 | Bacteria | 855 |
| 28 | Ga0264413_115698 | 3300024493 | Unclassified | 6664 |
| 29 | Ga0466699_073455 | 3300042597 | Bacteria | 8832 |
| 30 | JGI24698J34947_10012076 | 3300002449 | Bacteria | 4739 |
| 31 | JGI24695J34938_10000190 | 3300002450 | Bacteria | 57427 |
| 32 | Ga0466712_224544 | 3300042614 | Bacteria | 1229 |
| 33 | Ga0466718_053522 | 3300042617 | Bacteria | 1151 |
| 34 | Ga0466703_145012 | 3300042636 | Bacteria | 1295 |
| 35 | Ga0466727_152967 | 3300042655 | Bacteria | 6329 |
| 36 | Ga0466720_126946 | 3300042607 | Unclassified | 1261 |
| 37 | Ga0123353_10247024 | 3300010167 | Bacteria | 2767 |
| 38 | Ga0264413_126788 | 3300024493 | Unclassified | 3804 |
| 39 | Ga0466691_116974 | 3300042593 | Bacteria | 7752 |
| 40 | Ga0466694_164195 | 3300042594 | Bacteria | 1465 |
| 41 | Ga0466696_318009 | 3300042596 | Bacteria | 1107 |
| 42 | JGI24698J34947_10009859 | 3300002449 | Bacteria | 5237 |
| 43 | Ga0466729_066771 | 3300042621 | Bacteria | 1175 |
| 44 | Ga0466705_338426 | 3300042612 | Bacteria | 1165 |
| 45 | Ga0466732_181505 | 3300042656 | Bacteria | 2926 |
| 46 | Ga0466704_268117 | 3300042643 | Bacteria | 56383 |
| 47 | Ga0466722_060397 | 3300042609 | Bacteria | 28397 |
| 48 | Ga0264413_126806 | 3300024493 | Bacteria | 1723 |
| 49 | Ga0466694_039648 | 3300042594 | Bacteria | 3596 |
| 50 | JGI24695J34938_10355976 | 3300002450 | Bacteria | 644 |
| 51 | Ga0466715_269810 | 3300042616 | Bacteria | 39825 |
| 52 | Ga0466718_043628 | 3300042617 | Bacteria | 9408 |
| 53 | Ga0466726_217562 | 3300042619 | Bacteria | 1348 |
| 54 | Ga0466732_117160 | 3300042656 | Unclassified | 1345 |
| 55 | Ga0466732_208126 | 3300042656 | Bacteria | 3722 |
| 56 | Ga0466704_251320 | 3300042643 | Bacteria | 235343 |
| 57 | Ga0466713_074228 | 3300042602 | Unclassified | 1110 |
| 58 | Ga0466719_046072 | 3300042606 | Bacteria | 1653 |
| 59 | Ga0466720_054667 | 3300042607 | Bacteria | 1876 |
| 60 | Ga0466722_141023 | 3300042609 | Bacteria | 4203 |
| 61 | Ga0264413_100035 | 3300024493 | Bacteria | 16622 |
| 62 | Ga0264413_132701 | 3300024493 | Unclassified | 6339 |
| 63 | Ga0264413_135310 | 3300024493 | Bacteria | 1630 |
| 64 | Ga0456237_0021714 | 3300041968 | Bacteria | 885 |
| 65 | Ga0466699_033381 | 3300042597 | Bacteria | 2629 |
| 66 | 2230956392 | 2228664003 | Bacteria | 563 |
| 67 | JGI24698J34947_10001977 | 3300002449 | Bacteria | 10943 |
| 68 | Ga0072940_1041913 | 3300005200 | Bacteria | 1745 |
| 69 | Ga0466712_137915 | 3300042614 | Bacteria | 2201 |
| 70 | Ga0466718_029776 | 3300042617 | Bacteria | 3385 |
| 71 | Ga0466718_122156 | 3300042617 | Bacteria | 10586 |
| 72 | Ga0466723_368274 | 3300042618 | Bacteria | 8949 |
| 73 | Ga0466705_030017 | 3300042612 | Bacteria | 1446 |
| 74 | Ga0466705_107386 | 3300042612 | Bacteria | 18231 |
| 75 | Ga0466705_165175 | 3300042612 | Bacteria | 16731 |
| 76 | Ga0466703_046056 | 3300042636 | Bacteria | 73078 |
| 77 | Ga0466709_068591 | 3300042648 | Bacteria | 3252 |
| 78 | Ga0466692_022503 | 3300042591 | Bacteria | 7625 |
| 79 | Ga0466696_472484 | 3300042596 | Bacteria | 17752 |
| 80 | Ga0466699_398538 | 3300042597 | Bacteria | 1115 |
| 81 | AustNasuHG_c1001565 | 3300000089 | Bacteria | 8240 |
| 82 | JGI24698J34947_10006950 | 3300002449 | Bacteria | 6222 |
| 83 | JGI24695J34938_10070941 | 3300002450 | Bacteria | 1456 |
| 84 | JGI24702J35022_10020081 | 3300002462 | Bacteria | 3630 |
| 85 | Ga0466712_077098 | 3300042614 | Bacteria | 3563 |
| 86 | Ga0466712_215315 | 3300042614 | Bacteria | 1497 |
| 87 | Ga0466711_177258 | 3300042615 | Bacteria | 9560 |
| 88 | Ga0466715_036799 | 3300042616 | Bacteria | 1469 |
| 89 | Ga0466715_581844 | 3300042616 | Bacteria | 2095 |
| 90 | Ga0466726_470682 | 3300042619 | Bacteria | 2246 |
| 91 | Ga0466705_372520 | 3300042612 | Bacteria | 1966 |
| 92 | Ga0466704_469591 | 3300042643 | Unclassified | 1586 |
| 93 | Ga0466719_008274 | 3300042606 | Bacteria | 17743 |
| 94 | Ga0466720_000333 | 3300042607 | Bacteria | 4285 |
| 95 | Ga0123353_10666378 | 3300010167 | Bacteria | 1469 |
| 96 | Ga0466690_311799 | 3300042590 | Bacteria | 2073 |
| 97 | JGI24698J34947_10003388 | 3300002449 | Bacteria | 8652 |
| 98 | JGI24695J34938_10077057 | 3300002450 | Bacteria | 1384 |
| 99 | JGI24699J35502_11130441 | 3300002509 | Unclassified | 5107 |
| 100 | Ga0466727_212147 | 3300042655 | Bacteria | 3265 |
| 101 | Ga0123356_13695120 | 3300010049 | Bacteria | 529 |
| 102 | Ga0123353_10002681 | 3300010167 | Bacteria | 22181 |
| 103 | Ga0123353_10578031 | 3300010167 | Bacteria | 1613 |
| 104 | Ga0466699_261362 | 3300042597 | Unclassified | 3801 |
| 105 | Ga0466699_442862 | 3300042597 | Bacteria | 3635 |
| 106 | Ga0466712_246854 | 3300042614 | Bacteria | 15016 |
| 107 | Ga0466715_035889 | 3300042616 | Bacteria | 9863 |
| 108 | Ga0466718_059243 | 3300042617 | Bacteria | 1112 |
| 109 | Ga0466723_181255 | 3300042618 | Bacteria | 1831 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.