Protein Family IF10229
Metagenome
Isolate
186
Members
41
Samples
178
Scaffolds
108.6
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_092388|Ga0466732_092388_2124_2510
- Length
- 128 aa
- Sequence
- MIRCLSIRIKRLFNAIEGLVWMVEQELKTALGKNIKFLRFRRRFSQADLAEEAHISITFLSNIERGNNFPQPRTLCNLAEALDVQVWELFKGEGPLDHQETAIVDRLSEDFIKHVNLAMETVHKQYKT
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
65.8%
Unclassified
18.4%
Kalotermitidae
13.2%
Rhinotermitidae
2.6%
Taxonomy
Archaea
2
Bacteria
149
Eukaryota
0
Viruses
1
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 2 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 14 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 26 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 30 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 38 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 39 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_178798 | 3300042656 | Bacteria | 2445 |
| 2 | Ga0123356_10050539 | 3300010049 | Bacteria | 3868 |
| 3 | Ga0466712_271304 | 3300042614 | Bacteria | 1062 |
| 4 | Ga0466715_180970 | 3300042616 | Bacteria | 1334 |
| 5 | Ga0466718_012225 | 3300042617 | Bacteria | 2950 |
| 6 | Ga0466702_450656 | 3300042635 | Bacteria | 1280 |
| 7 | Ga0264413_124392 | 3300024493 | Bacteria | 1858 |
| 8 | Ga0415639_114097 | 3300038395 | Bacteria | 1734 |
| 9 | Ga0466694_230555 | 3300042594 | Bacteria | 4479 |
| 10 | AustNasuHG_c1012561 | 3300000089 | Bacteria | 2923 |
| 11 | JGI24698J34947_10018569 | 3300002449 | Bacteria | 3756 |
| 12 | JGI24698J34947_10047668 | 3300002449 | Bacteria | 2174 |
| 13 | JGI24698J34947_10069225 | 3300002449 | Unclassified | 1703 |
| 14 | JGI24698J34947_10095577 | 3300002449 | Unclassified | 1350 |
| 15 | JGI24698J34947_10318363 | 3300002449 | Unclassified | 554 |
| 16 | JGI24695J34938_10001068 | 3300002450 | Bacteria | 24786 |
| 17 | JGI24695J34938_10021158 | 3300002450 | Unclassified | 3186 |
| 18 | JGI24695J34938_10033987 | 3300002450 | Bacteria | 2342 |
| 19 | JGI24695J34938_10383689 | 3300002450 | Bacteria | 623 |
| 20 | JGI24697J35500_11201915 | 3300002507 | Bacteria | 1680 |
| 21 | Ga0072940_1072626 | 3300005200 | Bacteria | 2254 |
| 22 | Ga0072941_1073722 | 3300005201 | Bacteria | 1960 |
| 23 | Ga0466720_063325 | 3300042607 | Bacteria | 2035 |
| 24 | Ga0466720_135900 | 3300042607 | Bacteria | 5966 |
| 25 | Ga0466732_092224 | 3300042656 | Bacteria | 3897 |
| 26 | Ga0466732_283877 | 3300042656 | Bacteria | 2188 |
| 27 | Ga0466732_306800 | 3300042656 | Bacteria | 1125 |
| 28 | Ga0123356_10047937 | 3300010049 | Bacteria | 3975 |
| 29 | Ga0123356_10641235 | 3300010049 | Bacteria | 1229 |
| 30 | Ga0123353_10226358 | 3300010167 | Bacteria | 2919 |
| 31 | Ga0466712_135660 | 3300042614 | Unclassified | 1929 |
| 32 | Ga0466712_246102 | 3300042614 | Bacteria | 4737 |
| 33 | Ga0466715_136031 | 3300042616 | Bacteria | 1081 |
| 34 | Ga0466718_042872 | 3300042617 | Unclassified | 2266 |
| 35 | Ga0466718_097981 | 3300042617 | Unclassified | 1664 |
| 36 | Ga0466723_040433 | 3300042618 | Bacteria | 1532 |
| 37 | Ga0466704_004848 | 3300042643 | Bacteria | 3791 |
| 38 | Ga0415639_051162 | 3300038395 | Bacteria | 4831 |
| 39 | Ga0466690_021480 | 3300042590 | Bacteria | 4265 |
| 40 | Ga0466694_404720 | 3300042594 | Bacteria | 2227 |
| 41 | AustNasuHG_c1010952 | 3300000089 | Unclassified | 3148 |
| 42 | JGI24698J34947_10198204 | 3300002449 | Unclassified | 788 |
| 43 | JGI24698J34947_10312985 | 3300002449 | Bacteria | 562 |
| 44 | JGI24695J34938_10074389 | 3300002450 | Bacteria | 1413 |
| 45 | JGI24695J34938_10154546 | 3300002450 | Unclassified | 941 |
| 46 | Ga0466720_014287 | 3300042607 | Bacteria | 6510 |
| 47 | Ga0466720_053229 | 3300042607 | Bacteria | 1755 |
| 48 | Ga0466720_135334 | 3300042607 | Bacteria | 2018 |
| 49 | Ga0466732_427550 | 3300042656 | Bacteria | 1318 |
| 50 | Ga0123356_11213215 | 3300010049 | Bacteria | 920 |
| 51 | Ga0123353_10979421 | 3300010167 | Bacteria | 1139 |
| 52 | Ga0466718_101536 | 3300042617 | Bacteria | 2228 |
| 53 | Ga0466718_108536 | 3300042617 | Bacteria | 1859 |
| 54 | Ga0466718_134158 | 3300042617 | Bacteria | 5161 |
| 55 | Ga0264413_101335 | 3300024493 | Bacteria | 2878 |
| 56 | Ga0466694_019308 | 3300042594 | Bacteria | 2254 |
| 57 | Ga0466694_032257 | 3300042594 | Bacteria | 1547 |
| 58 | Ga0466699_014312 | 3300042597 | Unclassified | 2034 |
| 59 | AustNasuHG_c1010649 | 3300000089 | Unclassified | 3199 |
| 60 | FAAS_10657090 | 3300001880 | Bacteria | 540 |
| 61 | JGI24695J34938_10049393 | 3300002450 | Bacteria | 1849 |
| 62 | JGI24695J34938_10164935 | 3300002450 | Archaea | 912 |
| 63 | Ga0072940_1013263 | 3300005200 | Bacteria | 4897 |
| 64 | Ga0072941_1017224 | 3300005201 | Bacteria | 17207 |
| 65 | Ga0072941_1024457 | 3300005201 | Bacteria | 5304 |
| 66 | Ga0466720_057081 | 3300042607 | Unclassified | 1553 |
| 67 | Ga0466720_113394 | 3300042607 | Bacteria | 5216 |
| 68 | Ga0466720_140937 | 3300042607 | Bacteria | 22369 |
| 69 | Ga0466698_071674 | 3300042610 | Bacteria | 4485 |
| 70 | Ga0123356_10050288 | 3300010049 | Unclassified | 3879 |
| 71 | Ga0466712_062960 | 3300042614 | Bacteria | 2745 |
| 72 | Ga0466712_183737 | 3300042614 | Unclassified | 1267 |
| 73 | Ga0466718_105399 | 3300042617 | Bacteria | 1060 |
| 74 | Ga0466708_018272 | 3300042652 | Bacteria | 1315 |
| 75 | Ga0264413_116659 | 3300024493 | Bacteria | 3513 |
| 76 | Ga0415639_020980 | 3300038395 | Bacteria | 5967 |
| 77 | Ga0466694_144661 | 3300042594 | Bacteria | 3501 |
| 78 | Ga0466694_157518 | 3300042594 | Bacteria | 1256 |
| 79 | Ga0466694_194774 | 3300042594 | Bacteria | 2089 |
| 80 | Ga0466699_180708 | 3300042597 | Bacteria | 2079 |
| 81 | AustNasuHG_c1012502 | 3300000089 | Bacteria | 2931 |
| 82 | AustNasuHG_c1014488 | 3300000089 | Bacteria | 2679 |
| 83 | JGI24698J34947_10078031 | 3300002449 | Bacteria | 1564 |
| 84 | JGI24695J34938_10032397 | 3300002450 | Bacteria | 2415 |
| 85 | JGI24695J34938_10107244 | 3300002450 | Bacteria | 1139 |
| 86 | JGI24695J34938_10183587 | 3300002450 | Bacteria | 867 |
| 87 | Ga0466717_204132 | 3300042604 | Bacteria | 1170 |
| 88 | Ga0466720_066678 | 3300042607 | Bacteria | 8491 |
| 89 | Ga0466720_069293 | 3300042607 | Bacteria | 1482 |
| 90 | Ga0466720_178854 | 3300042607 | Unclassified | 5619 |
| 91 | Ga0466720_221088 | 3300042607 | Bacteria | 31188 |
| 92 | Ga0466732_092388 | 3300042656 | Bacteria | 4828 |
| 93 | Ga0466732_178938 | 3300042656 | Unclassified | 3639 |
| 94 | Ga0123356_10000269 | 3300010049 | Bacteria | 59524 |
| 95 | Ga0123356_10071986 | 3300010049 | Bacteria | 3246 |
| 96 | Ga0123353_10178887 | 3300010167 | Bacteria | 3360 |
| 97 | Ga0123354_10100907 | 3300010882 | Bacteria | 3902 |
| 98 | Ga0466718_017559 | 3300042617 | Bacteria | 3208 |
| 99 | Ga0466718_047741 | 3300042617 | Bacteria | 2114 |
| 100 | Ga0466731_034302 | 3300042622 | Bacteria | 6869 |
| 101 | Ga0466693_276147 | 3300042592 | Bacteria | 1085 |
| 102 | Ga0466694_028845 | 3300042594 | Bacteria | 1722 |
| 103 | AustNasuHG_c1012663 | 3300000089 | Bacteria | 2910 |
| 104 | AustNasuHG_c1012993 | 3300000089 | Unclassified | 2864 |
| 105 | AustNasuHG_c1014216 | 3300000089 | Bacteria | 2712 |
| 106 | AustNasuHG_c1042757 | 3300000089 | Bacteria | 1074 |
| 107 | JGI24698J34947_10101340 | 3300002449 | Unclassified | 1294 |
| 108 | JGI24698J34947_10119982 | 3300002449 | Bacteria | 1143 |
| 109 | Ga0072940_1254688 | 3300005200 | Bacteria | 904 |
| 110 | Ga0466698_263470 | 3300042610 | Bacteria | 2548 |
| 111 | Ga0466732_186284 | 3300042656 | Bacteria | 12295 |
| 112 | Ga0123355_12130422 | 3300009826 | Bacteria | 515 |
| 113 | Ga0123356_10000102 | 3300010049 | Bacteria | 90045 |
| 114 | Ga0123356_10044059 | 3300010049 | Unclassified | 4153 |
| 115 | Ga0123356_10117740 | 3300010049 | Bacteria | 2578 |
| 116 | Ga0123353_12288372 | 3300010167 | Bacteria | 650 |
| 117 | Ga0466712_272587 | 3300042614 | Bacteria | 9718 |
| 118 | Ga0466718_035590 | 3300042617 | Bacteria | 1899 |
| 119 | Ga0466718_147793 | 3300042617 | Bacteria | 4518 |
| 120 | Ga0415639_127991 | 3300038395 | Bacteria | 1325 |
| 121 | Ga0466694_402432 | 3300042594 | Bacteria | 5371 |
| 122 | Ga0466699_129070 | 3300042597 | Bacteria | 1141 |
| 123 | Ga0466699_148759 | 3300042597 | Bacteria | 2560 |
| 124 | AustNasuHG_c1012332 | 3300000089 | Bacteria | 2951 |
| 125 | JGI24698J34947_10014474 | 3300002449 | Bacteria | 4296 |
| 126 | JGI24698J34947_10027632 | 3300002449 | Bacteria | 3009 |
| 127 | JGI24698J34947_10042727 | 3300002449 | Unclassified | 2327 |
| 128 | JGI24695J34938_10000381 | 3300002450 | Bacteria | 43934 |
| 129 | JGI24695J34938_10014282 | 3300002450 | Bacteria | 4124 |
| 130 | JGI24695J34938_10022542 | 3300002450 | Unclassified | 3055 |
| 131 | JGI24702J35022_10845440 | 3300002462 | Bacteria | 570 |
| 132 | Ga0072940_1010137 | 3300005200 | Bacteria | 2188 |
| 133 | Ga0072940_1038467 | 3300005200 | Unclassified | 3779 |
| 134 | Ga0072941_1023773 | 3300005201 | Bacteria | 16468 |
| 135 | Ga0466720_124320 | 3300042607 | Bacteria | 4239 |
| 136 | Ga0466733_207493 | 3300042659 | Bacteria | 1334 |
| 137 | Ga0466712_226811 | 3300042614 | Bacteria | 1450 |
| 138 | Ga0466712_298982 | 3300042614 | Unclassified | 1610 |
| 139 | Ga0466718_088015 | 3300042617 | Unclassified | 1360 |
| 140 | Ga0466718_105816 | 3300042617 | Bacteria | 1714 |
| 141 | Ga0264413_100696 | 3300024493 | Bacteria | 17520 |
| 142 | Ga0466694_064650 | 3300042594 | Bacteria | 1306 |
| 143 | Ga0466694_068724 | 3300042594 | Bacteria | 15512 |
| 144 | AustNasuHG_c1001622 | 3300000089 | Bacteria | 8108 |
| 145 | AustNasuHG_c1004857 | 3300000089 | Bacteria | 4811 |
| 146 | FAAS_10486071 | 3300001880 | Bacteria | 530 |
| 147 | JGI24698J34947_10087254 | 3300002449 | Bacteria | 1443 |
| 148 | JGI24698J34947_10292198 | 3300002449 | Unclassified | 591 |
| 149 | JGI24698J34947_10325962 | 3300002449 | Unclassified | 545 |
| 150 | JGI24695J34938_10090676 | 3300002450 | Archaea | 1254 |
| 151 | JGI24699J35502_10618720 | 3300002509 | Unclassified | 696 |
| 152 | JGI24699J35502_10733781 | 3300002509 | Unclassified | 800 |
| 153 | Ga0466722_045521 | 3300042609 | Bacteria | 5517 |
| 154 | Ga0123356_10355028 | 3300010049 | Bacteria | 1591 |
| 155 | Ga0123356_10900847 | 3300010049 | Bacteria | 1056 |
| 156 | Ga0123353_10669370 | 3300010167 | Bacteria | 1465 |
| 157 | Ga0123353_11905834 | 3300010167 | Bacteria | 733 |
| 158 | Ga0466712_318652 | 3300042614 | Bacteria | 4171 |
| 159 | Ga0466718_008611 | 3300042617 | Bacteria | 1925 |
| 160 | Ga0466718_026075 | 3300042617 | Bacteria | 12343 |
| 161 | Ga0466718_075327 | 3300042617 | Bacteria | 8975 |
| 162 | Ga0466718_146770 | 3300042617 | Unclassified | 1400 |
| 163 | Ga0466731_425550 | 3300042622 | Viruses | 3317 |
| 164 | Ga0466702_343424 | 3300042635 | Bacteria | 6351 |
| 165 | Ga0264413_145868 | 3300024493 | Unclassified | 1029 |
| 166 | Ga0466694_103729 | 3300042594 | Bacteria | 9752 |
| 167 | Ga0466694_236771 | 3300042594 | Bacteria | 1167 |
| 168 | AustNasuHG_c1011337 | 3300000089 | Bacteria | 3090 |
| 169 | FAAS_10835561 | 3300001880 | Bacteria | 556 |
| 170 | JGI24698J34947_10000292 | 3300002449 | Bacteria | 21722 |
| 171 | JGI24698J34947_10081056 | 3300002449 | Bacteria | 1522 |
| 172 | JGI24698J34947_10146063 | 3300002449 | Unclassified | 989 |
| 173 | JGI24695J34938_10002386 | 3300002450 | Bacteria | 14430 |
| 174 | JGI24695J34938_10160423 | 3300002450 | Bacteria | 924 |
| 175 | JGI24696J40584_12953287 | 3300002834 | Unclassified | 2461 |
| 176 | Ga0072940_1067132 | 3300005200 | Bacteria | 812 |
| 177 | Ga0466720_043968 | 3300042607 | Unclassified | 1396 |
| 178 | Ga0466698_038726 | 3300042610 | Bacteria | 1115 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.