Protein Family IF10186

Metagenome Isolate
184 Members
61 Samples
170 Scaffolds
509.41 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_270522|Ga0466727_270522_3150_4835
Length
561 aa
Sequence
MSIAGGQAFSIFCSHRSFFSVSLQNFFDGQLQIRRQARRGEINLFGQMDIIEDTGFSLKSLKGIILKGEEIVLSDITKKRVAACFDFLETFSTEKIIYGINTGFGPMAQYRIDNESLMQLQYNIIRSHSTGAGAPLPDLYVRAAMVARLGTFLQARSGVHFELVELLIEFINRGIYPFVPEHGSVGASGDLVQLAHIALTLIGEGEVHYNGAWIPAKEALDANGLTPFRIHIREGLSVTNGTSVMTGIGIVNLIYARRLLEWATLASVWMNEIASSYDDLMSDELNRTKRHADQHEIARWMRLFARGGACLQKREIKLYDHAHAHEKVFTEKIQAYYSLRCAPQVLGPVLTAIRQAEKILVDEVNSACDNPIIDCESGNVYHGGNFHGDYVSFEMDKLKIAVTKLTMLMERQLNYLCHDRINDGILPPFLNLGVRGLNYGLQAAQFTATSTTAENQTLSNPMSIHSIPCNNDNQDIVSMGTNAALMAKTVIENAWQVTAIHYMALTQATECLGIAGKLSFQTRRTYADIRKIFPAEAEDTPKYREIAAVKEYLTHHAPELI

📊 Sample Types

Isolate 7.6%
Metagenome 92.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Kalotermitidae 23.3%
Unclassified 18.3%
Blattidae 6.7%
Rhinotermitidae 5.0%
Termopsidae 5.0%
Passalidae 3.3%
Armadillidiidae 1.7%
Hodotermitidae 1.7%
Nephropidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 182
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2882250448 Bizionia sp. APA-3 Isolate
7 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
8 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
17 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
20 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
21 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
22 3004667792 Bacteroides sp. 519 Isolate Blattidae
23 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
26 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
30 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
31 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
32 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
33 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
34 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
39 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
40 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
41 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
42 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
43 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
44 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
45 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
50 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
51 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
52 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
53 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
54 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
55 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
56 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
57 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
58 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
59 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
60 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
61 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_208476 3300042612 Bacteria 5967
2 Ga0466733_044551 3300042659 Bacteria 2245
3 Ga0466707_063845 3300042601 Bacteria 8868
4 Ga0466713_043123 3300042602 Bacteria 81226
5 Ga0466713_049669 3300042602 Bacteria 3414
6 Ga0466714_134893 3300042603 Bacteria 4620
7 Ga0466714_158735 3300042603 Bacteria 13111
8 Ga0466719_499653 3300042606 Bacteria 1986
9 Ga0466722_154847 3300042609 Bacteria 2309
10 Ga0466703_210249 3300042636 Bacteria 11501
11 Ga0466704_151657 3300042643 Bacteria 2919
12 Ga0466724_21271 3300042649 Bacteria 4583
13 Ga0466690_015023 3300042590 Bacteria 27335
14 Ga0466690_063142 3300042590 Bacteria 12647
15 Ga0466690_120487 3300042590 Bacteria 49787
16 Ga0466692_046708 3300042591 Bacteria 150257
17 Ga0466696_165406 3300042596 Bacteria 15212
18 Ga0466711_016056 3300042615 Bacteria 3895
19 Ga0466711_045136 3300042615 Bacteria 25795
20 Ga0466711_278242 3300042615 Bacteria 27669
21 Ga0466711_340642 3300042615 Bacteria 19711
22 Ga0466715_309128 3300042616 Bacteria 18162
23 Ga0466728_221052 3300042620 Bacteria 15724
24 Ga0466728_281160 3300042620 Bacteria 13069
25 Ga0466728_372833 3300042620 Bacteria 4556
26 JGI24696J40584_12961677 3300002834 Bacteria 34081
27 Ga0068305_10014021 3300005083 Bacteria 5645
28 Ga0466705_264324 3300042612 Bacteria 17030
29 Ga0466705_315418 3300042612 Bacteria 36789
30 Ga0466705_372016 3300042612 Bacteria 17065
31 Ga0466733_018691 3300042659 Bacteria 7747
32 Ga0466733_035383 3300042659 Bacteria 60826
33 Ga0123353_10064852 3300010167 Bacteria 5862
34 Ga0466706_218375 3300042599 Bacteria 57228
35 Ga0466700_193309 3300042600 Bacteria 37158
36 Ga0466713_033344 3300042602 Bacteria 37079
37 Ga0466716_031359 3300042605 Bacteria 13466
38 Ga0466719_009948 3300042606 Bacteria 7289
39 Ga0466719_449519 3300042606 Bacteria 14404
40 Ga0466722_023973 3300042609 Bacteria 11071
41 Ga0466731_336997 3300042622 Bacteria 40948
42 Ga0466727_120065 3300042655 Bacteria 6775
43 Ga0466691_028335 3300042593 Bacteria 20105
44 Ga0466695_330923 3300042595 Bacteria 4603
45 Ga0466701_015312 3300042598 Bacteria 9824
46 Ga0466710_162759 3300042613 Bacteria 7608
47 Ga0466723_287832 3300042618 Bacteria 14308
48 Ga0466728_222804 3300042620 Bacteria 2638
49 Ga0466705_158223 3300042612 Bacteria 15543
50 Ga0466733_064215 3300042659 Bacteria 7594
51 Ga0123353_10054406 3300010167 Bacteria 6400
52 Ga0123353_10282514 3300010167 Bacteria 2548
53 Ga0466714_021774 3300042603 Bacteria 11888
54 Ga0466714_135156 3300042603 Bacteria 46237
55 Ga0466716_041784 3300042605 Bacteria 12286
56 Ga0466722_006441 3300042609 Bacteria 9912
57 Ga0466722_021911 3300042609 Bacteria 53346
58 Ga0466722_042797 3300042609 Bacteria 13226
59 Ga0466735_138918 3300042624 Bacteria 5162
60 Ga0466735_158460 3300042624 Bacteria 7315
61 Ga0466703_173935 3300042636 Bacteria 16868
62 Ga0466703_217268 3300042636 Bacteria 30172
63 Ga0466704_102498 3300042643 Bacteria 21970
64 Ga0466709_279583 3300042648 Bacteria 6500
65 Ga0466724_02291 3300042649 Bacteria 3950
66 Ga0466708_187729 3300042652 Bacteria 24305
67 Ga0466727_172844 3300042655 Bacteria 7424
68 Ga0466690_319186 3300042590 Bacteria 19732
69 Ga0466691_006190 3300042593 Bacteria 85330
70 Ga0466711_075016 3300042615 Bacteria 12505
71 Ga0466715_340747 3300042616 Bacteria 15029
72 Ga0466726_301212 3300042619 Unclassified 2839
73 Ga0466728_010149 3300042620 Bacteria 2570
74 Ga0466728_116793 3300042620 Bacteria 97907
75 Ga0466705_130431 3300042612 Bacteria 14655
76 Ga0466705_158758 3300042612 Bacteria 11045
77 Ga0466733_187358 3300042659 Bacteria 6340
78 Ga0123356_10032917 3300010049 Bacteria 4847
79 Ga0123353_10086243 3300010167 Bacteria 5056
80 Ga0123354_10011041 3300010882 Bacteria 13936
81 Ga0466716_202600 3300042605 Bacteria 25648
82 Ga0466716_241172 3300042605 Bacteria 3486
83 Ga0466703_129758 3300042636 Bacteria 19384
84 Ga0466709_137910 3300042648 Bacteria 40589
85 Ga0466709_315607 3300042648 Bacteria 6478
86 Ga0466708_347084 3300042652 Bacteria 11166
87 Ga0466691_039935 3300042593 Bacteria 25425
88 Ga0466691_051351 3300042593 Bacteria 7659
89 Ga0466711_219626 3300042615 Bacteria 16517
90 Ga0466711_384618 3300042615 Bacteria 22548
91 Ga0466728_046855 3300042620 Bacteria 21751
92 JGI24696J40584_12955961 3300002834 Bacteria 2977
93 Ga0466705_182143 3300042612 Bacteria 4669
94 Ga0466705_365057 3300042612 Bacteria 11803
95 Ga0123357_10010479 3300009784 Bacteria 11793
96 Ga0123356_10000138 3300010049 Bacteria 82103
97 Ga0123356_10083711 3300010049 Bacteria 3022
98 Ga0466713_086346 3300042602 Bacteria 12025
99 Ga0466713_137191 3300042602 Bacteria 44160
100 Ga0466714_040261 3300042603 Bacteria 10231
101 Ga0466735_050611 3300042624 Bacteria 11617
102 Ga0466704_002372 3300042643 Bacteria 57196
103 Ga0466704_094724 3300042643 Bacteria 10795
104 Ga0466709_331194 3300042648 Bacteria 8170
105 Ga0466727_005019 3300042655 Bacteria 2887
106 Ga0466727_270522 3300042655 Bacteria 9416
107 Ga0160467_104640 3300012829 Bacteria 1896
108 Ga0466690_126870 3300042590 Bacteria 3111
109 Ga0466696_013750 3300042596 Bacteria 6973
110 Ga0466711_204147 3300042615 Bacteria 19807
111 JGI24695J34938_10002176 3300002450 Bacteria 15288
112 Ga0123354_10232662 3300010882 Bacteria 1921
113 Ga0466707_327113 3300042601 Bacteria 3225
114 Ga0466716_291493 3300042605 Bacteria 16470
115 Ga0466722_059383 3300042609 Bacteria 11770
116 Ga0466698_053877 3300042610 Bacteria 1910
117 Ga0466704_100467 3300042643 Bacteria 21863
118 Ga0466704_156837 3300042643 Bacteria 12573
119 Ga0466708_061784 3300042652 Bacteria 8976
120 Ga0466690_051493 3300042590 Bacteria 11140
121 Ga0466692_202069 3300042591 Bacteria 2364
122 Ga0466696_120177 3300042596 Bacteria 12396
123 Ga0466696_340248 3300042596 Bacteria 11516
124 Ga0466711_261761 3300042615 Bacteria 7646
125 Ga0466715_404214 3300042616 Bacteria 35013
126 Ga0466723_002914 3300042618 Bacteria 32279
127 Ga0466723_072995 3300042618 Bacteria 71631
128 Ga0466729_195397 3300042621 Bacteria 9904
129 JGI24702J35022_10002422 3300002462 Bacteria 11391
130 JGI24702J35022_10071318 3300002462 Bacteria 1871
131 JGI24696J40584_12961652 3300002834 Bacteria 28415
132 Ga0123353_10002651 3300010167 Bacteria 22277
133 Ga0466707_134177 3300042601 Bacteria 1987
134 Ga0466714_083434 3300042603 Bacteria 6796
135 Ga0466714_124180 3300042603 Bacteria 24229
136 Ga0466716_025176 3300042605 Bacteria 14391
137 Ga0466704_012910 3300042643 Bacteria 8254
138 Ga0466704_141833 3300042643 Bacteria 10073
139 Ga0466708_060683 3300042652 Bacteria 49198
140 Ga0466727_093739 3300042655 Bacteria 17800
141 Ga0466657_392747 3300042582 Bacteria 1866
142 Ga0466690_126528 3300042590 Bacteria 5048
143 Ga0466690_227385 3300042590 Bacteria 20859
144 Ga0466692_010939 3300042591 Bacteria 6058
145 Ga0466693_300446 3300042592 Bacteria 3405
146 Ga0466696_426152 3300042596 Bacteria 4582
147 Ga0466715_036672 3300042616 Bacteria 23788
148 Ga0466715_539776 3300042616 Bacteria 10244
149 Ga0466728_433988 3300042620 Bacteria 3539
150 2227502413 2225789004 Bacteria 19081
151 JGI24705J35276_12233371 3300002504 Bacteria 4809
152 Ga0466697_192850 3300042611 Bacteria 17708
153 Ga0123353_10138027 3300010167 Bacteria 3909
154 Ga0123354_10123407 3300010882 Bacteria 3326
155 Ga0466706_054201 3300042599 Bacteria 6950
156 Ga0466707_140740 3300042601 Bacteria 10682
157 Ga0466714_115794 3300042603 Bacteria 9635
158 Ga0466722_265049 3300042609 Bacteria 14900
159 Ga0466735_178543 3300042624 Bacteria 5627
160 Ga0466657_105158 3300042582 Bacteria 4192
161 Ga0466690_255880 3300042590 Bacteria 9031
162 Ga0466692_097315 3300042591 Bacteria 10528
163 Ga0466696_091816 3300042596 Bacteria 11965
164 Ga0466715_234297 3300042616 Bacteria 23273
165 Ga0466723_147104 3300042618 Bacteria 15942
166 Ga0466726_172879 3300042619 Bacteria 6101
167 Ga0466726_405595 3300042619 Bacteria 8079
168 Ga0466726_442357 3300042619 Bacteria 2343
169 IMNBGM34_c000511 3300000036 Bacteria 10296
170 Ga0068305_10057746 3300005083 Unclassified 11121

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00221 Lyase_aromatic Aromatic amino acid lyase 58 531 0.97

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.