Protein Family IF10178
Metagenome
Isolate
121
Members
40
Samples
117
Scaffolds
368.91
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_245563|Ga0466727_245563_1692_2921
- Length
- 409 aa
- Sequence
- MKKIIFPLCMFCLASCVFAQSSDHKKLFDKKYIKSTMLKVTEWQLANPNHDTRDWTNGAFYAGVFAAWETTKSKDVYKAMLDMGDKVNWTPYKRWYHADDVAICQTYIDIYRKEKRQEMIQSTIDTLSKFMANPYPVKGIEVIKWWWCDALFMAPPVLAKMGTTTGNPEYFKKNDIYFKECYDLLYNKEEHLFARDLNYVIKNDGNDRYEANGKRIFWSRGNGWVMGGLVRILKELPKDYSQRPFYEQLYKEMAAKIVSIQQADGLWRASLLDPDSYPGGEVSGSGFFCYALAWGINAGLLDKSTYLPAVKKSWIALNNCVNGEGRVGWVQPIGADPRKNFNADSWEVYGTGAFLLAGSEIIKLKKEESMREWRQNHRHRIRSYPICRAIRRRKSDVMMGMFRRVTGAS
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.9%
Termitidae
23.1%
Termopsidae
10.3%
Blattidae
7.7%
Rhinotermitidae
7.7%
Unclassified
7.7%
Passalidae
2.6%
Hydrophilidae
2.6%
Tenebrionidae
2.6%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 17 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 20 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 21 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 22 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 23 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_368263 | 3300042612 | Bacteria | 4400 |
| 2 | Ga0466733_077962 | 3300042659 | Bacteria | 19342 |
| 3 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 4 | Ga0466705_494640 | 3300042612 | Bacteria | 10023 |
| 5 | Ga0466715_258463 | 3300042616 | Bacteria | 28150 |
| 6 | Ga0466723_361650 | 3300042618 | Bacteria | 13087 |
| 7 | Ga0466728_110625 | 3300042620 | Bacteria | 42471 |
| 8 | Ga0466728_402272 | 3300042620 | Bacteria | 2534 |
| 9 | Ga0123356_10227701 | 3300010049 | Bacteria | 1926 |
| 10 | Ga0123353_10051765 | 3300010167 | Bacteria | 6553 |
| 11 | Ga0123353_10168830 | 3300010167 | Bacteria | 3475 |
| 12 | Ga0466729_283886 | 3300042621 | Bacteria | 1561 |
| 13 | Ga0466709_096263 | 3300042648 | Bacteria | 29719 |
| 14 | Ga0466708_051848 | 3300042652 | Bacteria | 9573 |
| 15 | Ga0466727_222909 | 3300042655 | Bacteria | 18189 |
| 16 | Ga0466707_120195 | 3300042601 | Bacteria | 3230 |
| 17 | Ga0466713_100201 | 3300042602 | Bacteria | 40435 |
| 18 | Ga0466714_105719 | 3300042603 | Bacteria | 7975 |
| 19 | Ga0466716_038572 | 3300042605 | Bacteria | 2132 |
| 20 | Ga0466693_167667 | 3300042592 | Bacteria | 1362 |
| 21 | Ga0466691_001050 | 3300042593 | Bacteria | 12292 |
| 22 | Ga0466705_401674 | 3300042612 | Bacteria | 8967 |
| 23 | Ga0466711_299662 | 3300042615 | Bacteria | 6865 |
| 24 | Ga0466711_512929 | 3300042615 | Bacteria | 34740 |
| 25 | Ga0466726_120645 | 3300042619 | Bacteria | 15026 |
| 26 | Ga0466704_534771 | 3300042643 | Bacteria | 20297 |
| 27 | Ga0466708_053720 | 3300042652 | Bacteria | 9924 |
| 28 | Ga0466708_084406 | 3300042652 | Bacteria | 7220 |
| 29 | Ga0068305_10047805 | 3300005083 | Bacteria | 10204 |
| 30 | Ga0466713_129443 | 3300042602 | Bacteria | 2226 |
| 31 | Ga0466690_053103 | 3300042590 | Bacteria | 2977 |
| 32 | Ga0466696_354588 | 3300042596 | Bacteria | 9039 |
| 33 | Ga0466705_378646 | 3300042612 | Bacteria | 13233 |
| 34 | Ga0466715_032997 | 3300042616 | Bacteria | 17847 |
| 35 | Ga0466715_107240 | 3300042616 | Bacteria | 39584 |
| 36 | Ga0466723_348379 | 3300042618 | Bacteria | 11357 |
| 37 | Ga0466728_010141 | 3300042620 | Bacteria | 10438 |
| 38 | Ga0466729_057315 | 3300042621 | Bacteria | 6451 |
| 39 | Ga0123353_10447870 | 3300010167 | Bacteria | 1902 |
| 40 | Ga0123354_10014914 | 3300010882 | Bacteria | 12107 |
| 41 | Ga0466727_167044 | 3300042655 | Bacteria | 32161 |
| 42 | Ga0466727_245563 | 3300042655 | Bacteria | 3440 |
| 43 | JGI24705J35276_12236124 | 3300002504 | Bacteria | 7508 |
| 44 | Ga0466713_026342 | 3300042602 | Bacteria | 39766 |
| 45 | Ga0466713_062780 | 3300042602 | Bacteria | 19729 |
| 46 | Ga0466714_128036 | 3300042603 | Bacteria | 5486 |
| 47 | Ga0466719_202584 | 3300042606 | Bacteria | 2119 |
| 48 | Ga0466722_039197 | 3300042609 | Bacteria | 6191 |
| 49 | Ga0466722_060929 | 3300042609 | Bacteria | 2750 |
| 50 | Ga0466722_154349 | 3300042609 | Bacteria | 3356 |
| 51 | Ga0466690_070479 | 3300042590 | Bacteria | 3700 |
| 52 | Ga0466690_143631 | 3300042590 | Bacteria | 10843 |
| 53 | Ga0466690_261819 | 3300042590 | Unclassified | 17369 |
| 54 | Ga0466692_116427 | 3300042591 | Bacteria | 133716 |
| 55 | Ga0466691_221216 | 3300042593 | Bacteria | 13784 |
| 56 | Ga0466705_325447 | 3300042612 | Bacteria | 1982 |
| 57 | Ga0466723_313763 | 3300042618 | Bacteria | 27327 |
| 58 | Ga0466728_298211 | 3300042620 | Bacteria | 4100 |
| 59 | Ga0466728_388918 | 3300042620 | Bacteria | 5805 |
| 60 | Ga0466703_082228 | 3300042636 | Bacteria | 4411 |
| 61 | Ga0466704_181630 | 3300042643 | Bacteria | 23359 |
| 62 | Ga0466708_024917 | 3300042652 | Bacteria | 2539 |
| 63 | Ga0466727_295895 | 3300042655 | Bacteria | 3089 |
| 64 | Ga0068302_10128338 | 3300005071 | Bacteria | 5945 |
| 65 | Ga0466713_108972 | 3300042602 | Bacteria | 12162 |
| 66 | Ga0466716_431468 | 3300042605 | Bacteria | 3005 |
| 67 | Ga0466690_163568 | 3300042590 | Bacteria | 12107 |
| 68 | Ga0466690_278049 | 3300042590 | Bacteria | 2823 |
| 69 | Ga0466733_203604 | 3300042659 | Bacteria | 66833 |
| 70 | Ga0466730_093731 | 3300042625 | Bacteria | 3664 |
| 71 | Ga0466704_062640 | 3300042643 | Bacteria | 1920 |
| 72 | Ga0466709_110604 | 3300042648 | Bacteria | 4690 |
| 73 | Ga0466713_132300 | 3300042602 | Bacteria | 21951 |
| 74 | Ga0466722_061395 | 3300042609 | Bacteria | 61869 |
| 75 | Ga0466722_249159 | 3300042609 | Bacteria | 79748 |
| 76 | Ga0466690_128007 | 3300042590 | Bacteria | 5721 |
| 77 | Ga0466692_108066 | 3300042591 | Bacteria | 15222 |
| 78 | Ga0466696_178693 | 3300042596 | Bacteria | 5946 |
| 79 | Ga0466705_134942 | 3300042612 | Bacteria | 4595 |
| 80 | Ga0466705_145242 | 3300042612 | Bacteria | 2651 |
| 81 | Ga0466705_171667 | 3300042612 | Bacteria | 5295 |
| 82 | Ga0466733_081995 | 3300042659 | Bacteria | 115844 |
| 83 | Ga0466728_247210 | 3300042620 | Bacteria | 9254 |
| 84 | Ga0466704_356361 | 3300042643 | Bacteria | 2603 |
| 85 | Ga0466708_381523 | 3300042652 | Bacteria | 10432 |
| 86 | Ga0466716_052540 | 3300042605 | Bacteria | 4072 |
| 87 | Ga0466690_034791 | 3300042590 | Bacteria | 2749 |
| 88 | Ga0466690_150232 | 3300042590 | Bacteria | 7827 |
| 89 | Ga0466692_009647 | 3300042591 | Bacteria | 10786 |
| 90 | Ga0466691_014224 | 3300042593 | Bacteria | 18492 |
| 91 | Ga0466705_200742 | 3300042612 | Bacteria | 6204 |
| 92 | Ga0466723_309462 | 3300042618 | Bacteria | 2221 |
| 93 | Ga0123356_10184162 | 3300010049 | Bacteria | 2113 |
| 94 | Ga0466703_159722 | 3300042636 | Bacteria | 8351 |
| 95 | Ga0466704_397345 | 3300042643 | Bacteria | 2960 |
| 96 | Ga0466704_402220 | 3300042643 | Bacteria | 34496 |
| 97 | Ga0466708_165208 | 3300042652 | Bacteria | 9729 |
| 98 | Ga0466708_186117 | 3300042652 | Bacteria | 16033 |
| 99 | JGI24696J40584_12934350 | 3300002834 | Bacteria | 1538 |
| 100 | Ga0466716_215719 | 3300042605 | Bacteria | 18909 |
| 101 | Ga0466719_400337 | 3300042606 | Bacteria | 12697 |
| 102 | Ga0466722_225310 | 3300042609 | Bacteria | 6520 |
| 103 | Ga0466711_137218 | 3300042615 | Bacteria | 4189 |
| 104 | Ga0466723_141613 | 3300042618 | Bacteria | 10974 |
| 105 | Ga0466723_246901 | 3300042618 | Bacteria | 2862 |
| 106 | Ga0466728_281316 | 3300042620 | Bacteria | 3655 |
| 107 | Ga0123356_10039058 | 3300010049 | Unclassified | 4423 |
| 108 | Ga0123354_10244562 | 3300010882 | Bacteria | 1836 |
| 109 | Ga0466735_004085 | 3300042624 | Bacteria | 3700 |
| 110 | Ga0466704_085637 | 3300042643 | Bacteria | 11308 |
| 111 | Ga0466709_087661 | 3300042648 | Bacteria | 14801 |
| 112 | 2227562400 | 2225789004 | Bacteria | 2708 |
| 113 | Ga0466713_137657 | 3300042602 | Bacteria | 5152 |
| 114 | Ga0466722_185555 | 3300042609 | Bacteria | 14474 |
| 115 | Ga0265387_1001222 | 3300024582 | Bacteria | 3796 |
| 116 | Ga0466690_189913 | 3300042590 | Bacteria | 2976 |
| 117 | Ga0466690_430694 | 3300042590 | Bacteria | 3544 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07470 | Glyco_hydro_88 | Glycosyl Hydrolase Family 88 | 32 | 364 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.