Protein Family IF10172
Metagenome
Isolate
163
Members
37
Samples
158
Scaffolds
138.23
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_232555|Ga0466727_232555_892_1344
- Length
- 150 aa
- Sequence
- MANLPGDSGTFGSAKLFTFEVHTPYRRFFSGQIEALSITLMDGEIGVYAQHSAFTAPVETCIMRIKDKTGVWRNAFTTEGILEVKEHKTVLMVDDAEWPAEIDHERAEAAKKRAEESLAGGLLTFEAVNVTASLKRAEFRLKAWEMRDLK
Sample Types
Isolate
3.1%
Metagenome
96.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
38.9%
Unclassified
22.2%
Termitidae
19.4%
Termopsidae
11.1%
Rhinotermitidae
5.6%
Hodotermitidae
2.8%
Taxonomy
Archaea
0
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 12 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 13 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 14 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_101868 | 3300042612 | Bacteria | 9253 |
| 2 | Ga0123353_10506823 | 3300010167 | Bacteria | 1756 |
| 3 | Ga0068302_10192997 | 3300005071 | Bacteria | 1634 |
| 4 | Ga0466735_187113 | 3300042624 | Bacteria | 1890 |
| 5 | Ga0466704_064422 | 3300042643 | Bacteria | 21275 |
| 6 | Ga0466704_180575 | 3300042643 | Bacteria | 3888 |
| 7 | Ga0466709_374563 | 3300042648 | Bacteria | 7422 |
| 8 | Ga0466727_174325 | 3300042655 | Bacteria | 1579 |
| 9 | Ga0466727_285964 | 3300042655 | Bacteria | 2205 |
| 10 | Ga0466711_346844 | 3300042615 | Bacteria | 1333 |
| 11 | Ga0466711_358404 | 3300042615 | Bacteria | 16250 |
| 12 | Ga0466715_327699 | 3300042616 | Unclassified | 1545 |
| 13 | Ga0466715_620458 | 3300042616 | Bacteria | 2046 |
| 14 | Ga0466723_159008 | 3300042618 | Bacteria | 56322 |
| 15 | Ga0466723_239041 | 3300042618 | Bacteria | 20681 |
| 16 | Ga0466726_042189 | 3300042619 | Bacteria | 3556 |
| 17 | Ga0466726_123188 | 3300042619 | Bacteria | 1021 |
| 18 | Ga0466726_211838 | 3300042619 | Bacteria | 1434 |
| 19 | Ga0466726_351593 | 3300042619 | Bacteria | 3320 |
| 20 | Ga0466726_463459 | 3300042619 | Bacteria | 1044 |
| 21 | Ga0466690_139402 | 3300042590 | Bacteria | 7223 |
| 22 | Ga0466690_263372 | 3300042590 | Bacteria | 14537 |
| 23 | Ga0466691_012186 | 3300042593 | Bacteria | 34485 |
| 24 | Ga0466696_122810 | 3300042596 | Bacteria | 28560 |
| 25 | Ga0466696_322765 | 3300042596 | Bacteria | 1848 |
| 26 | Ga0466707_405101 | 3300042601 | Bacteria | 1151 |
| 27 | Ga0466705_051501 | 3300042612 | Bacteria | 19408 |
| 28 | Ga0466705_251186 | 3300042612 | Bacteria | 13584 |
| 29 | Ga0123353_10473413 | 3300010167 | Bacteria | 1835 |
| 30 | Ga0466703_028796 | 3300042636 | Bacteria | 28449 |
| 31 | Ga0466703_186096 | 3300042636 | Bacteria | 1556 |
| 32 | Ga0466704_174431 | 3300042643 | Bacteria | 4224 |
| 33 | Ga0466708_023289 | 3300042652 | Bacteria | 34585 |
| 34 | Ga0466708_080930 | 3300042652 | Bacteria | 1408 |
| 35 | Ga0466708_372327 | 3300042652 | Bacteria | 6712 |
| 36 | Ga0466708_390178 | 3300042652 | Unclassified | 2494 |
| 37 | Ga0466727_022152 | 3300042655 | Bacteria | 2007 |
| 38 | Ga0466711_482150 | 3300042615 | Bacteria | 16436 |
| 39 | Ga0466723_006850 | 3300042618 | Bacteria | 2089 |
| 40 | Ga0466726_377033 | 3300042619 | Bacteria | 1105 |
| 41 | Ga0466728_065120 | 3300042620 | Bacteria | 2520 |
| 42 | Ga0466690_070030 | 3300042590 | Bacteria | 1764 |
| 43 | Ga0466691_013335 | 3300042593 | Bacteria | 5849 |
| 44 | Ga0466696_208749 | 3300042596 | Unclassified | 2156 |
| 45 | Ga0466706_227930 | 3300042599 | Bacteria | 2990 |
| 46 | Ga0466707_155644 | 3300042601 | Bacteria | 1706 |
| 47 | Ga0466713_011146 | 3300042602 | Bacteria | 6585 |
| 48 | Ga0466719_009063 | 3300042606 | Bacteria | 2789 |
| 49 | Ga0466705_032642 | 3300042612 | Bacteria | 4010 |
| 50 | Ga0466705_110020 | 3300042612 | Bacteria | 6614 |
| 51 | JGI24695J34938_10016747 | 3300002450 | Bacteria | 3717 |
| 52 | Ga0068305_10042695 | 3300005083 | Bacteria | 4530 |
| 53 | Ga0072941_1010599 | 3300005201 | Bacteria | 10350 |
| 54 | Ga0466703_421724 | 3300042636 | Bacteria | 2664 |
| 55 | Ga0466709_362068 | 3300042648 | Bacteria | 1245 |
| 56 | Ga0466708_195996 | 3300042652 | Bacteria | 3249 |
| 57 | Ga0466727_023057 | 3300042655 | Bacteria | 1210 |
| 58 | Ga0466727_186294 | 3300042655 | Bacteria | 2043 |
| 59 | Ga0466727_232555 | 3300042655 | Bacteria | 8420 |
| 60 | Ga0466727_281112 | 3300042655 | Bacteria | 3355 |
| 61 | Ga0466705_432079 | 3300042612 | Bacteria | 7180 |
| 62 | Ga0466715_349321 | 3300042616 | Bacteria | 29333 |
| 63 | Ga0466726_295781 | 3300042619 | Bacteria | 1242 |
| 64 | Ga0466726_465919 | 3300042619 | Bacteria | 1273 |
| 65 | Ga0466690_217031 | 3300042590 | Bacteria | 7022 |
| 66 | Ga0466691_064060 | 3300042593 | Bacteria | 14735 |
| 67 | Ga0466696_312523 | 3300042596 | Bacteria | 4580 |
| 68 | Ga0466696_318108 | 3300042596 | Bacteria | 9753 |
| 69 | Ga0466707_021022 | 3300042601 | Bacteria | 1346 |
| 70 | Ga0466707_330218 | 3300042601 | Bacteria | 1140 |
| 71 | Ga0466716_258582 | 3300042605 | Bacteria | 4593 |
| 72 | Ga0466722_062224 | 3300042609 | Bacteria | 2240 |
| 73 | Ga0466722_146128 | 3300042609 | Bacteria | 2076 |
| 74 | Ga0466705_363862 | 3300042612 | Bacteria | 12464 |
| 75 | Ga0466732_291159 | 3300042656 | Bacteria | 9643 |
| 76 | Ga0123356_12109738 | 3300010049 | Bacteria | 704 |
| 77 | JGI24695J34938_10019624 | 3300002450 | Unclassified | 3345 |
| 78 | Ga0466709_327711 | 3300042648 | Bacteria | 5591 |
| 79 | Ga0466708_351434 | 3300042652 | Bacteria | 21031 |
| 80 | Ga0466727_198607 | 3300042655 | Bacteria | 1222 |
| 81 | Ga0466711_162248 | 3300042615 | Bacteria | 9387 |
| 82 | Ga0466715_034023 | 3300042616 | Bacteria | 11177 |
| 83 | Ga0466723_217523 | 3300042618 | Bacteria | 11365 |
| 84 | Ga0466723_297703 | 3300042618 | Bacteria | 2417 |
| 85 | Ga0466690_282589 | 3300042590 | Bacteria | 1813 |
| 86 | Ga0466690_380368 | 3300042590 | Unclassified | 4693 |
| 87 | Ga0466690_434222 | 3300042590 | Bacteria | 3533 |
| 88 | Ga0466691_020643 | 3300042593 | Bacteria | 3955 |
| 89 | Ga0466696_084711 | 3300042596 | Bacteria | 44294 |
| 90 | Ga0466696_174191 | 3300042596 | Bacteria | 8099 |
| 91 | Ga0466696_174779 | 3300042596 | Bacteria | 1821 |
| 92 | Ga0466707_140198 | 3300042601 | Unclassified | 1146 |
| 93 | Ga0466707_142054 | 3300042601 | Bacteria | 1536 |
| 94 | Ga0466716_211648 | 3300042605 | Bacteria | 7730 |
| 95 | Ga0466719_126685 | 3300042606 | Bacteria | 6824 |
| 96 | Ga0123357_10019092 | 3300009784 | Bacteria | 9127 |
| 97 | Ga0123354_10269973 | 3300010882 | Bacteria | 1677 |
| 98 | Ga0072941_1010630 | 3300005201 | Bacteria | 8767 |
| 99 | Ga0466703_275780 | 3300042636 | Bacteria | 5623 |
| 100 | Ga0466704_067564 | 3300042643 | Bacteria | 49390 |
| 101 | Ga0466708_090762 | 3300042652 | Bacteria | 2360 |
| 102 | Ga0466708_220869 | 3300042652 | Unclassified | 1646 |
| 103 | Ga0466711_001917 | 3300042615 | Bacteria | 6029 |
| 104 | Ga0466723_219950 | 3300042618 | Bacteria | 6031 |
| 105 | Ga0466728_471193 | 3300042620 | Bacteria | 3620 |
| 106 | Ga0466692_155642 | 3300042591 | Bacteria | 2196 |
| 107 | Ga0466707_282175 | 3300042601 | Bacteria | 1196 |
| 108 | Ga0466719_335939 | 3300042606 | Bacteria | 5344 |
| 109 | Ga0466722_041289 | 3300042609 | Bacteria | 2409 |
| 110 | Ga0466705_108086 | 3300042612 | Bacteria | 3092 |
| 111 | JGI24695J34938_10025921 | 3300002450 | Bacteria | 2794 |
| 112 | JGI24695J34938_10208124 | 3300002450 | Bacteria | 817 |
| 113 | Ga0466735_066425 | 3300042624 | Bacteria | 33205 |
| 114 | Ga0466735_106461 | 3300042624 | Bacteria | 4811 |
| 115 | Ga0466703_195526 | 3300042636 | Bacteria | 3220 |
| 116 | Ga0466704_338399 | 3300042643 | Bacteria | 8645 |
| 117 | Ga0466704_499797 | 3300042643 | Bacteria | 2339 |
| 118 | Ga0466709_164537 | 3300042648 | Bacteria | 3690 |
| 119 | Ga0466715_612335 | 3300042616 | Unclassified | 1045 |
| 120 | Ga0466692_081289 | 3300042591 | Bacteria | 6259 |
| 121 | Ga0466691_144782 | 3300042593 | Bacteria | 35149 |
| 122 | Ga0466707_030476 | 3300042601 | Bacteria | 5937 |
| 123 | Ga0466719_420424 | 3300042606 | Bacteria | 2231 |
| 124 | Ga0466722_057019 | 3300042609 | Bacteria | 27648 |
| 125 | Ga0466698_365976 | 3300042610 | Bacteria | 1111 |
| 126 | Ga0466705_370225 | 3300042612 | Bacteria | 1461 |
| 127 | Ga0072941_1000558 | 3300005201 | Bacteria | 22267 |
| 128 | Ga0466735_082788 | 3300042624 | Bacteria | 1179 |
| 129 | Ga0466709_036318 | 3300042648 | Bacteria | 12405 |
| 130 | Ga0466708_167679 | 3300042652 | Bacteria | 2987 |
| 131 | Ga0466708_371738 | 3300042652 | Bacteria | 8764 |
| 132 | Ga0466715_004611 | 3300042616 | Bacteria | 7475 |
| 133 | Ga0466715_060772 | 3300042616 | Bacteria | 11366 |
| 134 | Ga0466723_053931 | 3300042618 | Bacteria | 3904 |
| 135 | Ga0466728_018580 | 3300042620 | Bacteria | 1475 |
| 136 | Ga0466690_298150 | 3300042590 | Bacteria | 1281 |
| 137 | Ga0466690_344488 | 3300042590 | Bacteria | 3332 |
| 138 | Ga0466696_048652 | 3300042596 | Bacteria | 8041 |
| 139 | Ga0466696_322514 | 3300042596 | Bacteria | 2241 |
| 140 | Ga0466696_343773 | 3300042596 | Bacteria | 2041 |
| 141 | Ga0466707_349834 | 3300042601 | Bacteria | 1904 |
| 142 | Ga0466716_158688 | 3300042605 | Bacteria | 17942 |
| 143 | Ga0466716_444073 | 3300042605 | Bacteria | 1255 |
| 144 | Ga0466722_145249 | 3300042609 | Bacteria | 4816 |
| 145 | Ga0123353_10278835 | 3300010167 | Bacteria | 2569 |
| 146 | JGI24695J34938_10039442 | 3300002450 | Bacteria | 2133 |
| 147 | Ga0068305_10013183 | 3300005083 | Bacteria | 994 |
| 148 | Ga0466704_034083 | 3300042643 | Bacteria | 4005 |
| 149 | Ga0466708_015194 | 3300042652 | Bacteria | 30430 |
| 150 | Ga0466708_275348 | 3300042652 | Bacteria | 53424 |
| 151 | Ga0466726_148653 | 3300042619 | Bacteria | 6976 |
| 152 | Ga0466726_210038 | 3300042619 | Bacteria | 1580 |
| 153 | Ga0466696_005819 | 3300042596 | Bacteria | 18142 |
| 154 | Ga0466707_088534 | 3300042601 | Bacteria | 1523 |
| 155 | Ga0466707_229936 | 3300042601 | Bacteria | 1103 |
| 156 | Ga0466716_016274 | 3300042605 | Bacteria | 7192 |
| 157 | Ga0466716_232694 | 3300042605 | Bacteria | 12135 |
| 158 | Ga0466716_273727 | 3300042605 | Bacteria | 1297 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02823 | GO:0015986 | proton motive force-driven ATP synthesis | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.