Protein Family IF10162

Metagenome Isolate
257 Members
58 Samples
243 Scaffolds
248.29 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_199285|Ga0466727_199285_906_1817
Length
290 aa
Sequence
MKTFYRKVEDGLKLPYLFPLIRLIRPCGYLLCTVIEEYNMKSVRTVFPAVLLVVSLLSVQAAFAQAPSAAELLRRVDDNEIYTTIEYDGEMIIDYQNRRYVKVFKAWARGNADSFMEFTNSEDRGTKYLKKGARLYVYSPDTEEVMLISGHMLKESMMGSDLSYEDTIDNEKLSARYNPALSGSEGWNGRDCWVLDLTAKKRTESYPKQKLWIDKENGDLLHYELYALSGAKLKEYTLLKAETIGGRRFPVEGEMRDLLRKNSKTTFVMKNVVLDKPIADSVFSTRNLER

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.9%
Kalotermitidae 25.0%
Unclassified 19.6%
Culicidae 7.1%
Rhinotermitidae 7.1%
Termopsidae 5.4%
Blaberidae 1.8%

🌳 Taxonomy

Archaea 6
Bacteria 224
Eukaryota 0
Viruses 0
Unclassified 27

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2964266314 Entomospira nematocera BR208 Isolate Culicidae
2 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 2820716747 Unclassified Fibrobacteres Nc150P3bin18 Isolate Unclassified
17 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
18 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
19 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 8063587521 Entomospira entomophilus BR193 Isolate Culicidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
37 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
38 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
39 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
42 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
47 8063589291 Entomospira nematocera BR208 Isolate Culicidae
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
52 2964130733 Entomospira entomophilus BR193 Isolate Culicidae
53 2772190975 Treponema sp. RmG30 Isolate Blaberidae
54 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
55 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
56 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
57 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
58 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466731_326598 3300042622 Bacteria 4374
2 Ga0466735_096895 3300042624 Bacteria 1159
3 Ga0466703_401117 3300042636 Unclassified 7346
4 Ga0466704_223905 3300042643 Bacteria 18923
5 Ga0466704_275114 3300042643 Bacteria 6812
6 Ga0466708_353818 3300042652 Unclassified 1344
7 Ga0466727_238560 3300042655 Unclassified 1483
8 Ga0466712_174793 3300042614 Bacteria 1817
9 Ga0466715_488342 3300042616 Archaea 3335
10 Ga0466718_080986 3300042617 Unclassified 3933
11 Ga0466718_089338 3300042617 Bacteria 11486
12 Ga0466723_065014 3300042618 Bacteria 13025
13 Ga0466726_174053 3300042619 Bacteria 1036
14 Ga0466726_493720 3300042619 Bacteria 2208
15 Ga0466728_184732 3300042620 Archaea 2605
16 Ga0466729_121408 3300042621 Bacteria 4940
17 Ga0466700_119857 3300042600 Bacteria 3197
18 Ga0466719_200041 3300042606 Archaea 2942
19 Ga0466719_241809 3300042606 Bacteria 59103
20 Ga0466719_278187 3300042606 Bacteria 19651
21 Ga0466720_026398 3300042607 Bacteria 5853
22 Ga0466722_109360 3300042609 Bacteria 2409
23 Ga0466722_185445 3300042609 Bacteria 1474
24 Ga0456237_0011775 3300041968 Bacteria 1273
25 Ga0466692_018781 3300042591 Unclassified 1504
26 Ga0466692_102496 3300042591 Bacteria 6892
27 Ga0466691_173625 3300042593 Bacteria 11802
28 Ga0466696_038136 3300042596 Bacteria 24965
29 Ga0466696_247247 3300042596 Bacteria 8764
30 JGI24698J34947_10148554 3300002449 Bacteria 976
31 Ga0466705_076616 3300042612 Bacteria 4947
32 Ga0466705_134412 3300042612 Bacteria 6118
33 Ga0466705_278602 3300042612 Unclassified 8149
34 Ga0466732_033449 3300042656 Bacteria 4462
35 Ga0466704_048106 3300042643 Bacteria 10720
36 Ga0466704_364518 3300042643 Bacteria 9604
37 Ga0466708_041247 3300042652 Bacteria 26897
38 Ga0466708_232460 3300042652 Bacteria 7256
39 Ga0466708_269645 3300042652 Bacteria 39521
40 Ga0466708_433694 3300042652 Bacteria 10449
41 Ga0466727_338041 3300042655 Bacteria 3289
42 Ga0123356_10013431 3300010049 Bacteria 7904
43 Ga0123353_10483378 3300010167 Unclassified 1811
44 Ga0466711_438813 3300042615 Bacteria 7417
45 Ga0466715_546547 3300042616 Archaea 2639
46 Ga0466718_015773 3300042617 Bacteria 16307
47 Ga0466718_027069 3300042617 Bacteria 3410
48 Ga0466726_151080 3300042619 Bacteria 1466
49 Ga0466726_301725 3300042619 Bacteria 1133
50 Ga0466719_036220 3300042606 Bacteria 6913
51 Ga0466719_317172 3300042606 Bacteria 2185
52 Ga0466719_388801 3300042606 Bacteria 2320
53 Ga0466722_085534 3300042609 Bacteria 12365
54 Ga0466698_516990 3300042610 Bacteria 2012
55 Ga0456237_0005347 3300041968 Unclassified 2037
56 Ga0466690_125523 3300042590 Bacteria 4556
57 Ga0466690_160194 3300042590 Unclassified 1088
58 Ga0466692_028558 3300042591 Bacteria 6652
59 Ga0466692_118040 3300042591 Bacteria 35776
60 Ga0466691_218458 3300042593 Bacteria 9075
61 Ga0466691_225205 3300042593 Bacteria 1424
62 Ga0466694_028043 3300042594 Bacteria 6267
63 Ga0466694_057428 3300042594 Bacteria 9195
64 JGI24698J34947_10005392 3300002449 Bacteria 7016
65 Ga0466705_348715 3300042612 Bacteria 3208
66 Ga0466702_054928 3300042635 Bacteria 4381
67 Ga0466702_089407 3300042635 Bacteria 1477
68 Ga0466702_234757 3300042635 Bacteria 4331
69 Ga0466703_014838 3300042636 Bacteria 48340
70 Ga0466703_196298 3300042636 Bacteria 4402
71 Ga0466703_379092 3300042636 Bacteria 15905
72 Ga0466704_352544 3300042643 Unclassified 5760
73 Ga0466704_441105 3300042643 Bacteria 7488
74 Ga0466708_330672 3300042652 Bacteria 1573
75 Ga0123356_10184587 3300010049 Bacteria 2111
76 Ga0466711_103177 3300042615 Bacteria 1798
77 Ga0466715_450397 3300042616 Bacteria 24675
78 Ga0466718_029449 3300042617 Unclassified 1080
79 Ga0466723_024109 3300042618 Bacteria 3192
80 Ga0466723_256253 3300042618 Bacteria 2704
81 Ga0466726_450259 3300042619 Bacteria 2288
82 Ga0466700_152183 3300042600 Bacteria 5421
83 Ga0466707_241225 3300042601 Bacteria 1184
84 Ga0466707_285206 3300042601 Bacteria 3475
85 Ga0466716_278022 3300042605 Bacteria 6045
86 Ga0466716_301656 3300042605 Unclassified 1144
87 Ga0466716_331558 3300042605 Bacteria 3953
88 Ga0466719_124166 3300042606 Bacteria 2549
89 Ga0466719_184763 3300042606 Bacteria 5337
90 Ga0466719_212888 3300042606 Unclassified 1310
91 Ga0466719_376702 3300042606 Bacteria 1233
92 Ga0466720_012602 3300042607 Bacteria 9216
93 Ga0466720_076660 3300042607 Bacteria 19001
94 Ga0466722_093119 3300042609 Bacteria 38866
95 Ga0264413_116457 3300024493 Bacteria 1783
96 Ga0456237_0009146 3300041968 Unclassified 1480
97 Ga0466690_005973 3300042590 Bacteria 18992
98 Ga0466690_241899 3300042590 Bacteria 2386
99 Ga0466690_416873 3300042590 Bacteria 3570
100 Ga0466692_067838 3300042591 Bacteria 10788
101 Ga0466692_128986 3300042591 Bacteria 6899
102 Ga0466691_029599 3300042593 Bacteria 2030
103 Ga0466696_014227 3300042596 Bacteria 3232
104 AustNasuHG_c1015368 3300000089 Bacteria 2584
105 JGI24695J34938_10009612 3300002450 Bacteria 5364
106 Ga0466705_066168 3300042612 Bacteria 12150
107 Ga0466729_259484 3300042621 Bacteria 1166
108 Ga0466708_029287 3300042652 Unclassified 1412
109 Ga0123353_10532969 3300010167 Bacteria 1699
110 Ga0466711_137198 3300042615 Bacteria 6723
111 Ga0466711_333849 3300042615 Bacteria 8643
112 Ga0466718_143047 3300042617 Bacteria 8167
113 Ga0466723_255018 3300042618 Bacteria 17244
114 Ga0466726_303961 3300042619 Bacteria 1158
115 Ga0466726_348587 3300042619 Bacteria 6253
116 Ga0466728_123075 3300042620 Bacteria 14623
117 Ga0466716_150835 3300042605 Bacteria 6766
118 Ga0466716_178981 3300042605 Bacteria 6806
119 Ga0466716_210240 3300042605 Bacteria 36809
120 Ga0466720_049113 3300042607 Bacteria 4463
121 Ga0466657_389477 3300042582 Bacteria 1104
122 Ga0466692_107282 3300042591 Bacteria 1932
123 Ga0466692_120140 3300042591 Bacteria 1674
124 Ga0466691_207569 3300042593 Bacteria 29392
125 Ga0466691_211579 3300042593 Bacteria 5188
126 Ga0466694_000605 3300042594 Bacteria 22276
127 Ga0466699_072654 3300042597 Bacteria 17368
128 Ga0466699_121916 3300042597 Unclassified 1146
129 AustNasuHG_c1007833 3300000089 Bacteria 3789
130 JGI24695J34938_10035158 3300002450 Bacteria 2293
131 Ga0466735_045766 3300042624 Bacteria 4980
132 Ga0466703_048507 3300042636 Bacteria 18694
133 Ga0466704_217161 3300042643 Bacteria 25376
134 Ga0466708_156747 3300042652 Bacteria 4461
135 Ga0466727_108729 3300042655 Bacteria 1968
136 Ga0466712_190304 3300042614 Bacteria 4661
137 Ga0466711_128328 3300042615 Bacteria 10167
138 Ga0466715_115539 3300042616 Bacteria 1912
139 Ga0466715_637480 3300042616 Bacteria 15129
140 Ga0466723_079629 3300042618 Bacteria 6999
141 Ga0466726_205927 3300042619 Bacteria 1668
142 Ga0466726_311783 3300042619 Bacteria 4185
143 Ga0466726_314504 3300042619 Bacteria 1709
144 Ga0466726_475757 3300042619 Bacteria 1187
145 Ga0466726_489923 3300042619 Bacteria 6155
146 Ga0466707_352223 3300042601 Bacteria 3486
147 Ga0466707_377433 3300042601 Bacteria 2899
148 Ga0466707_419176 3300042601 Bacteria 2505
149 Ga0466716_148910 3300042605 Bacteria 6222
150 Ga0466719_485211 3300042606 Unclassified 2799
151 Ga0466719_559672 3300042606 Bacteria 7257
152 Ga0466722_057246 3300042609 Bacteria 6572
153 Ga0466722_102407 3300042609 Archaea 3512
154 Ga0466698_352173 3300042610 Bacteria 1418
155 Ga0466691_033749 3300042593 Bacteria 14683
156 Ga0466691_112414 3300042593 Bacteria 1462
157 Ga0466696_002052 3300042596 Unclassified 3813
158 Ga0466699_272920 3300042597 Bacteria 1281
159 Ga0466699_338613 3300042597 Bacteria 3891
160 JGI24698J34947_10003731 3300002449 Bacteria 8291
161 Ga0466705_316133 3300042612 Unclassified 8186
162 Ga0466731_420954 3300042622 Bacteria 1998
163 Ga0466703_082066 3300042636 Bacteria 6439
164 Ga0466704_013982 3300042643 Bacteria 35618
165 Ga0466727_121806 3300042655 Bacteria 1481
166 Ga0466727_199285 3300042655 Bacteria 2854
167 Ga0466727_249147 3300042655 Bacteria 1337
168 Ga0123356_10032615 3300010049 Bacteria 4872
169 Ga0466705_400750 3300042612 Bacteria 2087
170 Ga0466723_030196 3300042618 Bacteria 35787
171 Ga0466723_355821 3300042618 Bacteria 4866
172 Ga0466707_257901 3300042601 Bacteria 2147
173 Ga0466707_386209 3300042601 Bacteria 1812
174 Ga0466713_097303 3300042602 Bacteria 11163
175 Ga0466713_102029 3300042602 Bacteria 1145
176 Ga0466719_195537 3300042606 Unclassified 1192
177 Ga0466719_290332 3300042606 Unclassified 1793
178 Ga0466720_093643 3300042607 Bacteria 3466
179 Ga0415639_150032 3300038395 Bacteria 5036
180 Ga0466692_188472 3300042591 Bacteria 1035
181 Ga0466691_190659 3300042593 Bacteria 2430
182 Ga0466696_168359 3300042596 Bacteria 8026
183 Ga0466696_384737 3300042596 Bacteria 3614
184 Ga0466699_199041 3300042597 Bacteria 6294
185 Ga0466699_275897 3300042597 Bacteria 1564
186 Ga0466699_351452 3300042597 Bacteria 2924
187 JGI24698J34947_10050200 3300002449 Unclassified 2105
188 JGI24695J34938_10004430 3300002450 Bacteria 9214
189 Ga0072941_1006083 3300005201 Bacteria 19263
190 Ga0466729_253823 3300042621 Bacteria 7467
191 Ga0466704_026986 3300042643 Unclassified 7198
192 Ga0466709_102114 3300042648 Bacteria 11300
193 Ga0466709_298980 3300042648 Bacteria 2321
194 Ga0466727_038328 3300042655 Bacteria 5547
195 Ga0466727_309104 3300042655 Bacteria 3984
196 Ga0123356_10001465 3300010049 Bacteria 26010
197 Ga0123356_10211455 3300010049 Bacteria 1989
198 Ga0466712_138533 3300042614 Bacteria 7141
199 Ga0466711_119435 3300042615 Bacteria 33923
200 Ga0466723_324111 3300042618 Bacteria 10065
201 Ga0466726_020944 3300042619 Bacteria 1999
202 Ga0466726_419201 3300042619 Bacteria 1126
203 Ga0466707_209407 3300042601 Bacteria 1392
204 Ga0466707_339889 3300042601 Bacteria 8340
205 Ga0466714_043675 3300042603 Bacteria 1018
206 Ga0466690_313406 3300042590 Bacteria 6851
207 Ga0466692_104856 3300042591 Unclassified 1917
208 Ga0466691_037950 3300042593 Bacteria 8349
209 Ga0466696_190675 3300042596 Bacteria 4075
210 JGI24695J34938_10005544 3300002450 Bacteria 7829
211 JGI24695J34938_10012423 3300002450 Bacteria 4512
212 Ga0466705_154824 3300042612 Bacteria 7324
213 Ga0466705_372263 3300042612 Bacteria 9689
214 Ga0466731_188679 3300042622 Bacteria 46828
215 Ga0466702_317458 3300042635 Unclassified 2091
216 Ga0466709_168624 3300042648 Bacteria 7491
217 Ga0466708_361630 3300042652 Unclassified 1994
218 Ga0466727_232512 3300042655 Bacteria 1458
219 Ga0123356_10055164 3300010049 Bacteria 3701
220 Ga0466715_061311 3300042616 Bacteria 9752
221 Ga0466715_185146 3300042616 Archaea 9345
222 Ga0466715_288483 3300042616 Bacteria 3249
223 Ga0466715_494091 3300042616 Unclassified 2047
224 Ga0466718_163097 3300042617 Bacteria 1593
225 Ga0466723_290189 3300042618 Bacteria 14987
226 Ga0466729_016514 3300042621 Bacteria 1112
227 Ga0466729_078803 3300042621 Bacteria 1037
228 Ga0466719_135610 3300042606 Bacteria 8698
229 Ga0466720_005047 3300042607 Bacteria 2894
230 Ga0456237_0000134 3300041968 Bacteria 10981
231 Ga0466690_173550 3300042590 Bacteria 3037
232 Ga0466690_177660 3300042590 Bacteria 15104
233 Ga0466692_048299 3300042591 Bacteria 5172
234 Ga0466692_131260 3300042591 Bacteria 16240
235 Ga0466691_007506 3300042593 Bacteria 38696
236 Ga0466691_105219 3300042593 Bacteria 3729
237 Ga0466695_380457 3300042595 Bacteria 78840
238 Ga0466696_126673 3300042596 Bacteria 6758
239 Ga0466696_159483 3300042596 Bacteria 8699
240 Ga0466699_314081 3300042597 Bacteria 17522
241 AustNasuHG_c1000245 3300000089 Bacteria 18355
242 JGI24695J34938_10005278 3300002450 Bacteria 8119
243 Ga0072941_1019021 3300005201 Bacteria 12829

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17131 LolA_like Outer membrane lipoprotein-sorting protein 111 290 0.98

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.