Protein Family IF10142
Metagenome
Isolate
159
Members
38
Samples
156
Scaffolds
338.47
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_114282|Ga0466727_114282_709_1848
- Length
- 379 aa
- Sequence
- LTDERPGGTDISGFSDTRLEHIQKLLRDNTIPKLEGDLADDPLLNEIHDELKAIREVLFSFSAGDFSPAIKVRGIIPGCLKALQAHLRHLIWQVQMIEKGDFTQEVRFMGEFSSAFNSMVHQLNKTLSELKQKEETLLDLTNTLRNEVDRRNSAVEALQESEARFKYLASHDALTGAFSRRSFIEMAGVELENAMKSGIHCCMAIMDIDHFKLFNDTYGHVAGDEALRHVVRVVQDGLRKGDFLGRYGGEEFTIFFYGSDEQTGMAIAERLRSALASSPVKLETQNVTVTASFGITKAEMDPKEDGFIQVLVNNADIALYGAKHAGRNKVMLYTPGMDDFSEGSRYSAFENEKTPVAEVADRGSPEAPAGEELQKEGAL
Sample Types
Isolate
1.9%
Metagenome
98.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.5%
Kalotermitidae
37.8%
Unclassified
8.1%
Rhinotermitidae
5.4%
Termopsidae
5.4%
Blaberidae
2.7%
Taxonomy
Archaea
0
Bacteria
159
Eukaryota
0
Viruses
0
Unclassified
0
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 20 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 32 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 33 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_044269 | 3300042612 | Bacteria | 14021 |
| 2 | Ga0466691_137157 | 3300042593 | Bacteria | 1995 |
| 3 | Ga0466699_097711 | 3300042597 | Bacteria | 3369 |
| 4 | Ga0466700_007758 | 3300042600 | Bacteria | 4731 |
| 5 | Ga0466719_151374 | 3300042606 | Bacteria | 12357 |
| 6 | Ga0466722_009440 | 3300042609 | Bacteria | 5887 |
| 7 | AustNasuHG_c1000531 | 3300000089 | Bacteria | 13377 |
| 8 | AustNasuHG_c1007348 | 3300000089 | Bacteria | 3925 |
| 9 | Ga0466728_136752 | 3300042620 | Bacteria | 8927 |
| 10 | Ga0466728_191965 | 3300042620 | Bacteria | 2737 |
| 11 | Ga0466704_145701 | 3300042643 | Bacteria | 9362 |
| 12 | Ga0466709_207212 | 3300042648 | Bacteria | 1443 |
| 13 | Ga0466709_409818 | 3300042648 | Bacteria | 2053 |
| 14 | Ga0466705_056610 | 3300042612 | Bacteria | 3172 |
| 15 | Ga0466732_346652 | 3300042656 | Bacteria | 2747 |
| 16 | Ga0466696_335071 | 3300042596 | Bacteria | 17726 |
| 17 | Ga0466716_493126 | 3300042605 | Bacteria | 2343 |
| 18 | Ga0466698_033797 | 3300042610 | Bacteria | 2734 |
| 19 | AustNasuHG_c1002019 | 3300000089 | Bacteria | 7305 |
| 20 | JGI24696J40584_12957801 | 3300002834 | Bacteria | 3697 |
| 21 | Ga0466711_165567 | 3300042615 | Bacteria | 4521 |
| 22 | Ga0466715_029825 | 3300042616 | Bacteria | 5429 |
| 23 | Ga0466715_393712 | 3300042616 | Bacteria | 7147 |
| 24 | Ga0466715_406418 | 3300042616 | Bacteria | 7867 |
| 25 | Ga0466704_126660 | 3300042643 | Bacteria | 17306 |
| 26 | Ga0466704_288691 | 3300042643 | Bacteria | 25350 |
| 27 | Ga0466708_035070 | 3300042652 | Bacteria | 8052 |
| 28 | Ga0466708_366320 | 3300042652 | Bacteria | 2351 |
| 29 | Ga0466705_378088 | 3300042612 | Bacteria | 2386 |
| 30 | Ga0264413_106913 | 3300024493 | Bacteria | 3423 |
| 31 | Ga0466699_230906 | 3300042597 | Bacteria | 2733 |
| 32 | Ga0466699_440015 | 3300042597 | Bacteria | 32912 |
| 33 | Ga0466699_443765 | 3300042597 | Bacteria | 1472 |
| 34 | Ga0123356_10002624 | 3300010049 | Bacteria | 19133 |
| 35 | Ga0466717_108553 | 3300042604 | Bacteria | 1657 |
| 36 | Ga0466719_118850 | 3300042606 | Bacteria | 22662 |
| 37 | Ga0466719_337352 | 3300042606 | Bacteria | 57418 |
| 38 | Ga0466722_063145 | 3300042609 | Bacteria | 10199 |
| 39 | Ga0466711_138756 | 3300042615 | Bacteria | 5744 |
| 40 | Ga0466715_101550 | 3300042616 | Bacteria | 22388 |
| 41 | Ga0466715_262591 | 3300042616 | Bacteria | 13449 |
| 42 | Ga0466703_061569 | 3300042636 | Bacteria | 36093 |
| 43 | Ga0466703_293836 | 3300042636 | Bacteria | 4405 |
| 44 | Ga0466704_425636 | 3300042643 | Bacteria | 27682 |
| 45 | Ga0466709_229356 | 3300042648 | Bacteria | 10871 |
| 46 | Ga0466708_270691 | 3300042652 | Bacteria | 1843 |
| 47 | Ga0466727_108990 | 3300042655 | Bacteria | 4884 |
| 48 | Ga0466727_192667 | 3300042655 | Bacteria | 2997 |
| 49 | Ga0466705_157947 | 3300042612 | Bacteria | 11546 |
| 50 | Ga0466690_000805 | 3300042590 | Bacteria | 10725 |
| 51 | Ga0466692_001629 | 3300042591 | Bacteria | 6740 |
| 52 | Ga0466691_098179 | 3300042593 | Bacteria | 2407 |
| 53 | Ga0466699_124294 | 3300042597 | Bacteria | 9843 |
| 54 | Ga0123353_10342206 | 3300010167 | Bacteria | 2258 |
| 55 | Ga0123353_10593496 | 3300010167 | Bacteria | 1585 |
| 56 | Ga0466713_086108 | 3300042602 | Bacteria | 4367 |
| 57 | Ga0466717_100560 | 3300042604 | Bacteria | 1594 |
| 58 | Ga0466719_352877 | 3300042606 | Bacteria | 2580 |
| 59 | Ga0466719_403421 | 3300042606 | Bacteria | 2677 |
| 60 | Ga0466719_404013 | 3300042606 | Bacteria | 1708 |
| 61 | Ga0466719_433578 | 3300042606 | Bacteria | 2363 |
| 62 | Ga0466722_045927 | 3300042609 | Bacteria | 4273 |
| 63 | Ga0466715_300901 | 3300042616 | Bacteria | 11889 |
| 64 | Ga0466715_337072 | 3300042616 | Bacteria | 7297 |
| 65 | Ga0466715_417230 | 3300042616 | Bacteria | 2914 |
| 66 | Ga0466723_046033 | 3300042618 | Bacteria | 1534 |
| 67 | Ga0466723_365662 | 3300042618 | Bacteria | 3570 |
| 68 | Ga0466726_040348 | 3300042619 | Bacteria | 2747 |
| 69 | Ga0466703_385211 | 3300042636 | Bacteria | 14194 |
| 70 | Ga0466709_292802 | 3300042648 | Bacteria | 6041 |
| 71 | Ga0466709_294203 | 3300042648 | Bacteria | 4723 |
| 72 | Ga0466692_124833 | 3300042591 | Bacteria | 6424 |
| 73 | Ga0466691_150593 | 3300042593 | Bacteria | 8027 |
| 74 | Ga0466696_335936 | 3300042596 | Bacteria | 3820 |
| 75 | Ga0466699_087510 | 3300042597 | Bacteria | 3084 |
| 76 | Ga0466699_145786 | 3300042597 | Bacteria | 5225 |
| 77 | Ga0466699_162096 | 3300042597 | Bacteria | 4814 |
| 78 | Ga0466699_177781 | 3300042597 | Bacteria | 3539 |
| 79 | Ga0466699_370677 | 3300042597 | Bacteria | 6829 |
| 80 | Ga0466719_336848 | 3300042606 | Bacteria | 2335 |
| 81 | Ga0466711_497683 | 3300042615 | Bacteria | 21552 |
| 82 | Ga0466715_503422 | 3300042616 | Bacteria | 2016 |
| 83 | Ga0466718_114256 | 3300042617 | Bacteria | 20301 |
| 84 | Ga0466718_169046 | 3300042617 | Bacteria | 8509 |
| 85 | Ga0466723_016478 | 3300042618 | Bacteria | 8392 |
| 86 | Ga0466723_086681 | 3300042618 | Bacteria | 9988 |
| 87 | Ga0466702_230368 | 3300042635 | Bacteria | 2101 |
| 88 | Ga0466703_016956 | 3300042636 | Bacteria | 4210 |
| 89 | Ga0466703_071234 | 3300042636 | Bacteria | 32935 |
| 90 | Ga0466709_238050 | 3300042648 | Bacteria | 17478 |
| 91 | Ga0466708_072583 | 3300042652 | Bacteria | 12329 |
| 92 | Ga0466708_144615 | 3300042652 | Bacteria | 2736 |
| 93 | Ga0466708_345314 | 3300042652 | Bacteria | 12077 |
| 94 | Ga0466727_151780 | 3300042655 | Bacteria | 2584 |
| 95 | Ga0466696_266622 | 3300042596 | Bacteria | 28910 |
| 96 | Ga0466699_037849 | 3300042597 | Bacteria | 7193 |
| 97 | Ga0466719_539676 | 3300042606 | Bacteria | 1959 |
| 98 | Ga0466721_232526 | 3300042608 | Bacteria | 21831 |
| 99 | Ga0466722_081445 | 3300042609 | Bacteria | 2036 |
| 100 | Ga0074263_110429 | 3300005485 | Bacteria | 4009 |
| 101 | Ga0466711_433809 | 3300042615 | Bacteria | 2358 |
| 102 | Ga0466711_441473 | 3300042615 | Bacteria | 41991 |
| 103 | Ga0466711_489650 | 3300042615 | Bacteria | 2018 |
| 104 | Ga0466715_046174 | 3300042616 | Bacteria | 30258 |
| 105 | Ga0466715_455355 | 3300042616 | Bacteria | 3027 |
| 106 | Ga0466718_158887 | 3300042617 | Bacteria | 2369 |
| 107 | Ga0466723_062733 | 3300042618 | Bacteria | 35703 |
| 108 | Ga0466723_095314 | 3300042618 | Bacteria | 1430 |
| 109 | Ga0466723_184754 | 3300042618 | Bacteria | 4752 |
| 110 | Ga0466726_363329 | 3300042619 | Bacteria | 2709 |
| 111 | Ga0466704_294164 | 3300042643 | Bacteria | 18628 |
| 112 | Ga0466709_058723 | 3300042648 | Bacteria | 26398 |
| 113 | Ga0466709_142334 | 3300042648 | Bacteria | 9021 |
| 114 | Ga0466708_324321 | 3300042652 | Bacteria | 2056 |
| 115 | Ga0466705_143282 | 3300042612 | Bacteria | 12501 |
| 116 | Ga0466705_183004 | 3300042612 | Bacteria | 8660 |
| 117 | Ga0466732_249100 | 3300042656 | Bacteria | 4755 |
| 118 | Ga0264413_116706 | 3300024493 | Bacteria | 3757 |
| 119 | Ga0466690_264197 | 3300042590 | Bacteria | 5270 |
| 120 | Ga0466716_095913 | 3300042605 | Bacteria | 14967 |
| 121 | Ga0466719_375318 | 3300042606 | Bacteria | 15596 |
| 122 | Ga0466719_533396 | 3300042606 | Bacteria | 3814 |
| 123 | Ga0466722_177742 | 3300042609 | Bacteria | 3848 |
| 124 | JGI24702J35022_10017331 | 3300002462 | Bacteria | 3937 |
| 125 | JGI24705J35276_12085623 | 3300002504 | Bacteria | 983 |
| 126 | Ga0466711_001692 | 3300042615 | Bacteria | 7510 |
| 127 | Ga0466711_109643 | 3300042615 | Bacteria | 13469 |
| 128 | Ga0466711_187823 | 3300042615 | Bacteria | 1806 |
| 129 | Ga0466715_003331 | 3300042616 | Bacteria | 4259 |
| 130 | Ga0466715_205003 | 3300042616 | Bacteria | 9057 |
| 131 | Ga0466723_009818 | 3300042618 | Bacteria | 36345 |
| 132 | Ga0466723_305681 | 3300042618 | Bacteria | 8089 |
| 133 | Ga0466726_130749 | 3300042619 | Bacteria | 7613 |
| 134 | Ga0466702_263846 | 3300042635 | Bacteria | 1261 |
| 135 | Ga0466703_354742 | 3300042636 | Bacteria | 2477 |
| 136 | Ga0466708_441406 | 3300042652 | Bacteria | 3338 |
| 137 | Ga0466727_114282 | 3300042655 | Bacteria | 2429 |
| 138 | Ga0264413_126263 | 3300024493 | Bacteria | 3059 |
| 139 | Ga0466691_048051 | 3300042593 | Bacteria | 6042 |
| 140 | Ga0466691_059090 | 3300042593 | Bacteria | 3639 |
| 141 | Ga0466691_106083 | 3300042593 | Bacteria | 2478 |
| 142 | Ga0466696_025719 | 3300042596 | Bacteria | 1397 |
| 143 | Ga0466699_130177 | 3300042597 | Bacteria | 1894 |
| 144 | Ga0466699_152253 | 3300042597 | Bacteria | 3355 |
| 145 | Ga0466717_201630 | 3300042604 | Bacteria | 1963 |
| 146 | Ga0466716_346497 | 3300042605 | Bacteria | 2899 |
| 147 | Ga0466716_361851 | 3300042605 | Bacteria | 3222 |
| 148 | Ga0466722_215244 | 3300042609 | Bacteria | 8638 |
| 149 | Ga0466711_050599 | 3300042615 | Bacteria | 2200 |
| 150 | Ga0466715_078285 | 3300042616 | Bacteria | 2435 |
| 151 | Ga0466702_269016 | 3300042635 | Bacteria | 3119 |
| 152 | Ga0466703_177369 | 3300042636 | Bacteria | 10116 |
| 153 | Ga0466708_041129 | 3300042652 | Bacteria | 7339 |
| 154 | Ga0466708_146878 | 3300042652 | Bacteria | 4364 |
| 155 | Ga0466708_248204 | 3300042652 | Bacteria | 39410 |
| 156 | Ga0466727_160182 | 3300042655 | Bacteria | 2413 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00990 | GGDEF | Diguanylate cyclase, GGDEF domain | 169 | 329 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.