Protein Family IF10070
Metagenome
Isolate
143
Members
114
Samples
80
Scaffolds
318.87
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_247386|Ga0466725_247386_1263_2348
- Length
- 361 aa
- Sequence
- VQKYDFIFEKAIDIGVIGHFLINEIPHQRIILISLHPNYFETAMKITEILEAEKGKNLISFEILPPIKGKSIDAITKILDPLMEFKPPFIDVTYHREEYEYKQTSAGYFEKIAVRKRPGTVGICAAIKYRYNVEAVPHFLCGGFTREETENALIDLAFLGIDNILALRGDARMMEKKFVPEPNGHHYAVNLVTQINNMNLGRYLDNDLINPVKTNFCIGVAGYPEKHFEAANYEEDMQYLKAKIDAGGDYIVTQMFFNNEVYFKFVDDCRKAGINVPIIPGLKPITRLSQLNTIPAAFYIDMPDILVKELRKTKDDAQAKQIGVDWCIAQSKELLKYGVPCLHYYTMGDVKTTSAICRAVL
Sample Types
Isolate
44.1%
Metagenome
55.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
18.8%
Unclassified
9.9%
Blaberidae
8.9%
Kalotermitidae
6.9%
Blattellidae
6.9%
Armadillidiidae
5.9%
Apidae
5.0%
Drosophilidae
4.0%
Pseudophyllodromiidae
3.0%
Corydiidae
3.0%
Blattidae
2.0%
Anaplectidae
2.0%
Passalidae
2.0%
Cryptocercidae
2.0%
Ectobiidae
2.0%
Elmidae
2.0%
Termopsidae
2.0%
Nyctiboridae
2.0%
Daphniidae
1.0%
Rhinotermitidae
1.0%
Formicidae
1.0%
Culicidae
1.0%
Hydrophilidae
1.0%
Tenebrionidae
1.0%
Tryonicidae
1.0%
Nephropidae
1.0%
Lamproblattidae
1.0%
Bombycidae
1.0%
Monophlebidae
1.0%
Cambaridae
1.0%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 2 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 3 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 4 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 5 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 14 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 15 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 16 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 17 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 23 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 24 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 31 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 32 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 33 | 2820727601 | Unclassified Cloacimonetes Nt197P3bin46 | Isolate | Unclassified |
| 34 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 35 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 36 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 37 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 38 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 39 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 40 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 43 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 46 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 49 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 50 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 53 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 54 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 55 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 56 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 57 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 58 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 59 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 60 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 61 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 62 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 63 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 64 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 65 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 66 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 67 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 68 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 69 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 70 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 71 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 72 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 73 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 74 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 75 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 76 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 77 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 78 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 79 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 80 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 81 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 82 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 83 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 84 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 85 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 86 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 87 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 88 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 89 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 90 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 91 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 92 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 93 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 94 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 95 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 96 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 97 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 98 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 99 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 100 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 101 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 102 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 103 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 104 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 105 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 106 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
| 107 | 3002003370 | Blattabacterium cuenoti THEREAreg | Isolate | Corydiidae |
| 108 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 109 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 110 | 3002008367 | Blattabacterium cuenoti PARANAUcir | Isolate | Blaberidae |
| 111 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 112 | 3002028747 | Blattabacterium cuenoti ESCALves | Isolate | Blattellidae |
| 113 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 114 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_160833 | 3300042659 | Bacteria | 20584 |
| 2 | Ga0466731_024840 | 3300042622 | Bacteria | 1594 |
| 3 | Ga0466734_070099 | 3300042623 | Bacteria | 2151 |
| 4 | Ga0466724_06685 | 3300042649 | Bacteria | 9036 |
| 5 | Ga0160468_100081 | 3300012819 | Bacteria | 123596 |
| 6 | Ga0160445_100117 | 3300012847 | Bacteria | 70337 |
| 7 | Ga0123357_10211278 | 3300009784 | Bacteria | 2179 |
| 8 | Ga0104048_1022167 | 3300007143 | Bacteria | 9547 |
| 9 | Ga0466710_012561 | 3300042613 | Bacteria | 1041 |
| 10 | Ga0466726_087814 | 3300042619 | Bacteria | 7061 |
| 11 | Ga0466726_459218 | 3300042619 | Bacteria | 9189 |
| 12 | Ga0466734_156050 | 3300042623 | Bacteria | 1280 |
| 13 | Ga0160472_100582 | 3300012839 | Unclassified | 20936 |
| 14 | Ga0415639_184317 | 3300038395 | Bacteria | 1038 |
| 15 | Ga0466657_174262 | 3300042582 | Bacteria | 38494 |
| 16 | Ga0466716_170902 | 3300042605 | Bacteria | 10991 |
| 17 | IMNBGM34_c003058 | 3300000036 | Bacteria | 2348 |
| 18 | Ga0072941_1231670 | 3300005201 | Bacteria | 3465 |
| 19 | Ga0104019_1004596 | 3300007150 | Unclassified | 3662 |
| 20 | Ga0466704_441782 | 3300042643 | Bacteria | 2246 |
| 21 | Ga0466724_07335 | 3300042649 | Bacteria | 37493 |
| 22 | Ga0466725_183455 | 3300042654 | Bacteria | 58079 |
| 23 | Ga0160467_103959 | 3300012829 | Bacteria | 2269 |
| 24 | Ga0466690_034885 | 3300042590 | Bacteria | 4458 |
| 25 | Ga0466695_389193 | 3300042595 | Bacteria | 1462 |
| 26 | Ga0466714_126554 | 3300042603 | Bacteria | 1200 |
| 27 | Ga0123356_10205954 | 3300010049 | Bacteria | 2011 |
| 28 | Ga0123353_10029174 | 3300010167 | Bacteria | 8497 |
| 29 | IMNBL1DRAFT_c0031248 | 3300000062 | Bacteria | 1940 |
| 30 | JGI24702J35022_10007558 | 3300002462 | Bacteria | 6219 |
| 31 | Ga0104048_1002233 | 3300007143 | Bacteria | 7718 |
| 32 | Ga0466724_27041 | 3300042649 | Unclassified | 2464 |
| 33 | Ga0160431_100264 | 3300012828 | Bacteria | 33418 |
| 34 | Ga0160444_100084 | 3300012841 | Bacteria | 124101 |
| 35 | Ga0160457_1000512 | 3300012858 | Bacteria | 16837 |
| 36 | Ga0264413_148282 | 3300024493 | Bacteria | 2507 |
| 37 | Ga0415639_016172 | 3300038395 | Bacteria | 35296 |
| 38 | Ga0466696_313677 | 3300042596 | Bacteria | 12494 |
| 39 | Ga0466714_153181 | 3300042603 | Bacteria | 120481 |
| 40 | Ga0104045_1004374 | 3300007085 | Bacteria | 9015 |
| 41 | Ga0104045_1075050 | 3300007085 | Bacteria | 2226 |
| 42 | Ga0104019_1003504 | 3300007150 | Unclassified | 8703 |
| 43 | Ga0466727_067800 | 3300042655 | Bacteria | 3071 |
| 44 | Ga0160453_100372 | 3300012814 | Bacteria | 37923 |
| 45 | Ga0466714_112855 | 3300042603 | Bacteria | 14336 |
| 46 | Ga0466717_251617 | 3300042604 | Bacteria | 2386 |
| 47 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 48 | Ga0103267_1000012 | 3300007190 | Bacteria | 65954 |
| 49 | Ga0466729_145143 | 3300042621 | Bacteria | 11122 |
| 50 | Ga0466701_052061 | 3300042598 | Unclassified | 9601 |
| 51 | Ga0466714_120004 | 3300042603 | Bacteria | 1402 |
| 52 | Ga0123353_10282156 | 3300010167 | Bacteria | 2550 |
| 53 | Ga0123354_10292103 | 3300010882 | Unclassified | 1560 |
| 54 | HBC_ctgsDRAFT_1000007 | 3300000333 | Bacteria | 60444 |
| 55 | Ga0072941_1001734 | 3300005201 | Bacteria | 34764 |
| 56 | Ga0104044_1147257 | 3300007136 | Bacteria | 1587 |
| 57 | Ga0104019_1005305 | 3300007150 | Bacteria | 5982 |
| 58 | Ga0103267_1000261 | 3300007190 | Bacteria | 20698 |
| 59 | Ga0466711_038594 | 3300042615 | Bacteria | 8155 |
| 60 | Ga0466726_251784 | 3300042619 | Bacteria | 2920 |
| 61 | Ga0466728_354057 | 3300042620 | Bacteria | 2909 |
| 62 | Ga0466725_247386 | 3300042654 | Bacteria | 2821 |
| 63 | Ga0466714_050529 | 3300042603 | Bacteria | 8726 |
| 64 | Ga0160466_100004 | 3300012809 | Bacteria | 532472 |
| 65 | IMNBGM34_c000683 | 3300000036 | Bacteria | 8200 |
| 66 | Ga0072941_1119041 | 3300005201 | Bacteria | 4397 |
| 67 | Ga0104045_1027661 | 3300007085 | Unclassified | 4707 |
| 68 | Ga0103267_1000365 | 3300007190 | Bacteria | 19591 |
| 69 | Ga0466733_094238 | 3300042659 | Bacteria | 11844 |
| 70 | Ga0466730_054806 | 3300042625 | Bacteria | 801523 |
| 71 | Ga0466724_45518 | 3300042649 | Bacteria | 226122 |
| 72 | Ga0466708_397897 | 3300042652 | Bacteria | 54943 |
| 73 | Ga0160472_100050 | 3300012839 | Bacteria | 194545 |
| 74 | Ga0160433_100012 | 3300012846 | Bacteria | 265415 |
| 75 | Ga0466694_158246 | 3300042594 | Bacteria | 2055 |
| 76 | Ga0466713_139066 | 3300042602 | Bacteria | 109882 |
| 77 | Ga0466713_146465 | 3300042602 | Bacteria | 20927 |
| 78 | Ga0072941_1012493 | 3300005201 | Bacteria | 10258 |
| 79 | Ga0072941_1246316 | 3300005201 | Bacteria | 1306 |
| 80 | Ga0072941_1476417 | 3300005201 | Bacteria | 1334 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02219 | MTHFR | Methylenetetrahydrofolate reductase | 51 | 358 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.