Protein Family IF10056
Metagenome
Isolate
118
Members
60
Samples
115
Scaffolds
288.39
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_139100|Ga0466725_139100_3259_4281
- Length
- 340 aa
- Sequence
- MIETMQLLSISEASKWASGYIGKNVTTSNIAYLIQYGLIRKIGENGSTRVMQSELQDYYKKYLSSREKVNTDIYLGNCKEILKTIPDNSIDLIVTSPPYADQRKNTYGGIHPDKYVEWFLPISKELLRVLKPTGTFILNIKEKVIDGERSTYVMELILEMRKQGWFWTEEFIWHKKNCYPGKWSNRFRDAWERLLQFNKNKKFNMYQDAVKVPIGNWASGRLKNLSETDKIRDNAKNGSGFGKNISNWVGKETVYPTNVVHLSTECNNKNHSAAFPDSLPEWFIKLFTQENDKVLDPFAGSGTTLKVAQRMGRNSIGIEIVPEYVELIKSNIKEYESQLF
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.7%
Kalotermitidae
20.3%
Formicidae
15.3%
Termopsidae
6.8%
Unclassified
6.8%
Rhinotermitidae
5.1%
Drosophilidae
3.4%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
101
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 2 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 3 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 4 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 5 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 6 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 7 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 8 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 9 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 10 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 11 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 12 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 13 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 14 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 19 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 31 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 32 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 40 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 50 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 51 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 52 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 53 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 54 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 55 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 56 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 57 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 58 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 59 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 60 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10480016 | 3300010167 | Bacteria | 1819 |
| 2 | Ga0123354_10209759 | 3300010882 | Bacteria | 2110 |
| 3 | Ga0466690_201729 | 3300042590 | Bacteria | 8749 |
| 4 | Ga0466691_129240 | 3300042593 | Bacteria | 2333 |
| 5 | Ga0466691_177757 | 3300042593 | Bacteria | 6331 |
| 6 | Ga0466694_065026 | 3300042594 | Bacteria | 24875 |
| 7 | JGI24705J35276_12197999 | 3300002504 | Bacteria | 1563 |
| 8 | JGI24705J35276_12227989 | 3300002504 | Bacteria | 3104 |
| 9 | Ga0074308_1000354 | 3300005307 | Unclassified | 2843 |
| 10 | Ga0466710_202567 | 3300042613 | Bacteria | 2182 |
| 11 | Ga0466712_168488 | 3300042614 | Unclassified | 5748 |
| 12 | Ga0466715_263107 | 3300042616 | Bacteria | 32267 |
| 13 | Ga0466726_464870 | 3300042619 | Bacteria | 3101 |
| 14 | Ga0466735_103147 | 3300042624 | Bacteria | 2449 |
| 15 | Ga0123353_10029008 | 3300010167 | Bacteria | 8518 |
| 16 | Ga0466693_073179 | 3300042592 | Bacteria | 1592 |
| 17 | AustNasuHG_c1044274 | 3300000089 | Bacteria | 1033 |
| 18 | JGI24695J34938_10059644 | 3300002450 | Bacteria | 1631 |
| 19 | JGI24702J35022_10055788 | 3300002462 | Bacteria | 2108 |
| 20 | Ga0103261_1000686 | 3300007083 | Bacteria | 5125 |
| 21 | Ga0102740_1000934 | 3300007140 | Bacteria | 7852 |
| 22 | Ga0102740_1019668 | 3300007140 | Bacteria | 1032 |
| 23 | Ga0102737_1000670 | 3300007142 | Bacteria | 10873 |
| 24 | Ga0466712_121317 | 3300042614 | Bacteria | 4714 |
| 25 | Ga0466723_206191 | 3300042618 | Bacteria | 1501 |
| 26 | Ga0466734_045539 | 3300042623 | Bacteria | 2427 |
| 27 | Ga0466704_144895 | 3300042643 | Bacteria | 3215 |
| 28 | Ga0466732_203551 | 3300042656 | Bacteria | 7699 |
| 29 | Ga0123353_10033043 | 3300010167 | Bacteria | 8045 |
| 30 | Ga0466692_105758 | 3300042591 | Bacteria | 1604 |
| 31 | Ga0466691_078837 | 3300042593 | Bacteria | 146609 |
| 32 | JGI24698J34947_10055735 | 3300002449 | Unclassified | 1968 |
| 33 | JGI24699J35502_11004455 | 3300002509 | Unclassified | 1368 |
| 34 | Ga0466701_086757 | 3300042598 | Bacteria | 2203 |
| 35 | Ga0466700_459869 | 3300042600 | Bacteria | 32609 |
| 36 | Ga0466719_029213 | 3300042606 | Bacteria | 1958 |
| 37 | Ga0466718_114206 | 3300042617 | Bacteria | 1286 |
| 38 | Ga0466690_051574 | 3300042590 | Bacteria | 4964 |
| 39 | Ga0072941_1240846 | 3300005201 | Bacteria | 2854 |
| 40 | Ga0102735_1000020 | 3300007080 | Bacteria | 41493 |
| 41 | Ga0102734_1004674 | 3300007129 | Bacteria | 3074 |
| 42 | Ga0102737_1000090 | 3300007142 | Unclassified | 27928 |
| 43 | Ga0105005_1043022 | 3300007505 | Bacteria | 2596 |
| 44 | Ga0466707_205888 | 3300042601 | Bacteria | 6158 |
| 45 | Ga0466716_057010 | 3300042605 | Bacteria | 13488 |
| 46 | Ga0466719_039991 | 3300042606 | Bacteria | 3209 |
| 47 | Ga0466722_223429 | 3300042609 | Unclassified | 2471 |
| 48 | Ga0466698_103295 | 3300042610 | Bacteria | 1288 |
| 49 | Ga0466710_452770 | 3300042613 | Bacteria | 1694 |
| 50 | Ga0466728_074526 | 3300042620 | Unclassified | 1884 |
| 51 | Ga0466728_290929 | 3300042620 | Bacteria | 48933 |
| 52 | Ga0466731_079789 | 3300042622 | Bacteria | 2539 |
| 53 | Ga0466703_144952 | 3300042636 | Bacteria | 5289 |
| 54 | Ga0466703_156951 | 3300042636 | Bacteria | 2709 |
| 55 | Ga0466704_136762 | 3300042643 | Bacteria | 15015 |
| 56 | Ga0466708_125967 | 3300042652 | Bacteria | 1938 |
| 57 | Ga0123356_10384305 | 3300010049 | Bacteria | 1537 |
| 58 | Ga0466693_121733 | 3300042592 | Bacteria | 1957 |
| 59 | JGI24702J35022_10022261 | 3300002462 | Bacteria | 3432 |
| 60 | JGI24705J35276_12210648 | 3300002504 | Unclassified | 1832 |
| 61 | Ga0072941_1057199 | 3300005201 | Bacteria | 4000 |
| 62 | Ga0466719_263353 | 3300042606 | Bacteria | 7103 |
| 63 | Ga0466721_149268 | 3300042608 | Bacteria | 2052 |
| 64 | Ga0466722_074547 | 3300042609 | Bacteria | 1580 |
| 65 | Ga0466718_094004 | 3300042617 | Bacteria | 1262 |
| 66 | Ga0466723_002147 | 3300042618 | Bacteria | 3082 |
| 67 | Ga0466728_090067 | 3300042620 | Bacteria | 1920 |
| 68 | Ga0466729_218541 | 3300042621 | Bacteria | 51957 |
| 69 | Ga0466705_369902 | 3300042612 | Bacteria | 10866 |
| 70 | Ga0123354_10000997 | 3300010882 | Bacteria | 32229 |
| 71 | Ga0466690_214494 | 3300042590 | Bacteria | 1269 |
| 72 | Ga0466691_110436 | 3300042593 | Bacteria | 10413 |
| 73 | JGI24698J34947_10018039 | 3300002449 | Unclassified | 3820 |
| 74 | JGI24698J34947_10108420 | 3300002449 | Bacteria | 1231 |
| 75 | Ga0466722_016171 | 3300042609 | Bacteria | 13736 |
| 76 | Ga0466710_005631 | 3300042613 | Unclassified | 1897 |
| 77 | Ga0466723_103256 | 3300042618 | Bacteria | 2732 |
| 78 | Ga0466723_166196 | 3300042618 | Bacteria | 2506 |
| 79 | Ga0466734_070939 | 3300042623 | Unclassified | 1410 |
| 80 | Ga0466734_086624 | 3300042623 | Bacteria | 4456 |
| 81 | Ga0466703_257391 | 3300042636 | Bacteria | 4588 |
| 82 | Ga0466708_129142 | 3300042652 | Unclassified | 2475 |
| 83 | Ga0466725_197398 | 3300042654 | Bacteria | 1613 |
| 84 | Ga0466727_122577 | 3300042655 | Bacteria | 2657 |
| 85 | Ga0466697_106239 | 3300042611 | Bacteria | 1316 |
| 86 | Ga0123356_10034202 | 3300010049 | Unclassified | 4751 |
| 87 | Ga0123353_10283112 | 3300010167 | Bacteria | 2544 |
| 88 | Ga0123354_10034459 | 3300010882 | Bacteria | 7918 |
| 89 | Ga0123354_10446889 | 3300010882 | Bacteria | 1050 |
| 90 | Ga0466693_213500 | 3300042592 | Bacteria | 1777 |
| 91 | Ga0466699_073579 | 3300042597 | Bacteria | 3904 |
| 92 | JGI24702J35022_10058335 | 3300002462 | Bacteria | 2062 |
| 93 | JGI24705J35276_12210638 | 3300002504 | Unclassified | 1831 |
| 94 | Ga0068302_10119755 | 3300005071 | Bacteria | 2688 |
| 95 | Ga0466700_305787 | 3300042600 | Bacteria | 3929 |
| 96 | Ga0466707_358833 | 3300042601 | Bacteria | 73282 |
| 97 | Ga0466697_006644 | 3300042611 | Bacteria | 4005 |
| 98 | Ga0466711_120256 | 3300042615 | Bacteria | 4872 |
| 99 | Ga0466732_427451 | 3300042656 | Bacteria | 2968 |
| 100 | Ga0123354_10317620 | 3300010882 | Unclassified | 1443 |
| 101 | Ga0466694_219885 | 3300042594 | Bacteria | 15206 |
| 102 | JGI24705J35276_12214773 | 3300002504 | Bacteria | 1974 |
| 103 | CVPL010W_10023753 | 3300002931 | Unclassified | 3118 |
| 104 | Ga0103263_100055 | 3300007042 | Bacteria | 27002 |
| 105 | Ga0103266_1001255 | 3300007067 | Bacteria | 6083 |
| 106 | Ga0102737_1000074 | 3300007142 | Bacteria | 37834 |
| 107 | Ga0103268_1001132 | 3300007192 | Bacteria | 7028 |
| 108 | Ga0466706_094395 | 3300042599 | Bacteria | 32166 |
| 109 | Ga0466700_153254 | 3300042600 | Bacteria | 4514 |
| 110 | Ga0466700_174926 | 3300042600 | Bacteria | 2005 |
| 111 | Ga0466728_105781 | 3300042620 | Bacteria | 7769 |
| 112 | Ga0466734_156511 | 3300042623 | Unclassified | 2546 |
| 113 | Ga0466703_073942 | 3300042636 | Bacteria | 1039 |
| 114 | Ga0466704_040407 | 3300042643 | Bacteria | 30014 |
| 115 | Ga0466725_139100 | 3300042654 | Bacteria | 5716 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01555 | N6_N4_Mtase | DNA methylase | 90 | 329 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.