Protein Family IF10027
Metagenome
Isolate
201
Members
128
Samples
122
Scaffolds
266.36
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_006744|Ga0466725_006744_791_1699
- Length
- 302 aa
- Sequence
- LSSCAKSQNLRGIWILRLRFALRCNDRKGFADIPLPEIKMPAALIFDIETIPDVAGLRRLHDLPESLSDAEVAEFAFQQRRAATGNDFLPHYQQRIVTISCALYSPGQLRVFSLSEPDNSEGEIIQRFFDGIEKYTPQLVSWNGGGFDLPVLHYRGLLHGIAAPRYWDLGDGDYADSREFKWNNYISRYHARHLDLMDLLALYQPRANAPLDELAKLMGYPGKLGMDGSAVWAAWQAGRIAEIRDYCETDVVNTGLVYLRFLKMRGFLGHEEWKREVAMVRETLEKIDAPHWKEFLAAWPGE
Sample Types
Isolate
39.3%
Metagenome
60.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
52.8%
Termitidae
14.2%
Unclassified
11.0%
Kalotermitidae
11.0%
Culicidae
3.9%
Termopsidae
3.1%
Rhinotermitidae
3.1%
Alydidae
0.8%
Taxonomy
Archaea
0
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 2 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 3 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 4 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 5 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 6 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 7 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 8 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 9 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Apidae |
| 10 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 17 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 18 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 23 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 24 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 25 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 26 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 27 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 28 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 29 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 30 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 31 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 32 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 39 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 40 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 41 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 44 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 45 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 46 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 47 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 48 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 49 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 56 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 57 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 58 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 59 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 60 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 61 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 62 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 63 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 64 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 65 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 66 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 67 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 68 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 69 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 70 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 71 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 72 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 73 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 74 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 75 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 76 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 77 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 78 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 79 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 80 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 81 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 82 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 83 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 84 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 85 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 86 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 87 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 88 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 89 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 90 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 91 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 92 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 93 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 94 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 95 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 96 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 97 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 98 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 99 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 100 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 101 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 102 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 103 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 104 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 105 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 106 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 107 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 108 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 109 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 110 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 111 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 112 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 113 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 114 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 115 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 116 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 117 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 118 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 119 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 120 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 121 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 122 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 123 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 124 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 125 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 126 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 127 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 128 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_008326 | 3300042612 | Bacteria | 11942 |
| 2 | Ga0160472_100192 | 3300012839 | Bacteria | 78508 |
| 3 | Ga0466692_024378 | 3300042591 | Bacteria | 43078 |
| 4 | Ga0466691_007631 | 3300042593 | Bacteria | 39863 |
| 5 | Ga0466707_220350 | 3300042601 | Bacteria | 2803 |
| 6 | Ga0466719_012986 | 3300042606 | Bacteria | 1821 |
| 7 | Ga0466722_110283 | 3300042609 | Bacteria | 2660 |
| 8 | Ga0123356_10304249 | 3300010049 | Bacteria | 1701 |
| 9 | Ga0123353_10331737 | 3300010167 | Bacteria | 2302 |
| 10 | Ga0160471_100073 | 3300012812 | Bacteria | 88780 |
| 11 | SCG598O11_11287 | 3300000471 | Unclassified | 10435 |
| 12 | JGI24702J35022_10001132 | 3300002462 | Bacteria | 16577 |
| 13 | Ga0466726_320542 | 3300042619 | Bacteria | 15234 |
| 14 | Ga0466729_207478 | 3300042621 | Bacteria | 3245 |
| 15 | Ga0466704_157730 | 3300042643 | Bacteria | 1222 |
| 16 | Ga0466733_106366 | 3300042659 | Bacteria | 32206 |
| 17 | Ga0466690_267281 | 3300042590 | Bacteria | 1279 |
| 18 | Ga0466693_263346 | 3300042592 | Bacteria | 1540 |
| 19 | Ga0466719_023847 | 3300042606 | Bacteria | 3401 |
| 20 | Ga0466719_568148 | 3300042606 | Bacteria | 4571 |
| 21 | Ga0123356_10045814 | 3300010049 | Bacteria | 4069 |
| 22 | HBC_ctgsDRAFT_1005467 | 3300000333 | Bacteria | 2978 |
| 23 | Ga0072941_1206258 | 3300005201 | Bacteria | 2306 |
| 24 | Ga0466710_259807 | 3300042613 | Bacteria | 51868 |
| 25 | Ga0466715_118393 | 3300042616 | Bacteria | 12375 |
| 26 | Ga0466715_134167 | 3300042616 | Bacteria | 2537 |
| 27 | Ga0466723_123251 | 3300042618 | Bacteria | 6118 |
| 28 | Ga0466726_188712 | 3300042619 | Bacteria | 2385 |
| 29 | Ga0466728_335275 | 3300042620 | Bacteria | 27023 |
| 30 | Ga0466725_006744 | 3300042654 | Bacteria | 11639 |
| 31 | Ga0466725_158336 | 3300042654 | Bacteria | 3660 |
| 32 | Ga0466727_314564 | 3300042655 | Bacteria | 4501 |
| 33 | Ga0466697_213063 | 3300042611 | Bacteria | 1339 |
| 34 | Ga0466657_207837 | 3300042582 | Bacteria | 1242 |
| 35 | Ga0466701_037737 | 3300042598 | Bacteria | 3236 |
| 36 | Ga0466701_102356 | 3300042598 | Bacteria | 4232 |
| 37 | Ga0466707_275452 | 3300042601 | Bacteria | 60681 |
| 38 | SCG598J21_12829 | 3300000475 | Bacteria | 52532 |
| 39 | Ga0466710_064557 | 3300042613 | Bacteria | 19103 |
| 40 | Ga0466710_432536 | 3300042613 | Unclassified | 25822 |
| 41 | Ga0466715_168887 | 3300042616 | Bacteria | 12621 |
| 42 | Ga0466715_371668 | 3300042616 | Bacteria | 5435 |
| 43 | Ga0466734_135222 | 3300042623 | Bacteria | 3323 |
| 44 | Ga0466735_168703 | 3300042624 | Bacteria | 2066 |
| 45 | Ga0466703_168755 | 3300042636 | Bacteria | 1532 |
| 46 | Ga0466708_207960 | 3300042652 | Unclassified | 3340 |
| 47 | Ga0466725_286534 | 3300042654 | Bacteria | 47104 |
| 48 | Ga0160470_101054 | 3300012813 | Bacteria | 7478 |
| 49 | Ga0466657_075374 | 3300042582 | Bacteria | 10554 |
| 50 | Ga0466657_301609 | 3300042582 | Bacteria | 34859 |
| 51 | Ga0466692_026545 | 3300042591 | Bacteria | 17802 |
| 52 | Ga0466695_068100 | 3300042595 | Bacteria | 6249 |
| 53 | Ga0466719_176315 | 3300042606 | Bacteria | 12961 |
| 54 | Ga0123353_10067235 | 3300010167 | Bacteria | 5754 |
| 55 | Ga0072941_1208734 | 3300005201 | Bacteria | 5213 |
| 56 | Ga0466715_463848 | 3300042616 | Bacteria | 9988 |
| 57 | Ga0466723_013943 | 3300042618 | Bacteria | 35948 |
| 58 | Ga0466723_208340 | 3300042618 | Bacteria | 44340 |
| 59 | Ga0466726_205831 | 3300042619 | Bacteria | 1804 |
| 60 | Ga0466735_215044 | 3300042624 | Bacteria | 1406 |
| 61 | Ga0466708_225063 | 3300042652 | Bacteria | 27011 |
| 62 | Ga0466708_377235 | 3300042652 | Bacteria | 24562 |
| 63 | Ga0466727_207965 | 3300042655 | Bacteria | 27912 |
| 64 | Ga0466705_265019 | 3300042612 | Bacteria | 1261 |
| 65 | Ga0415639_230619 | 3300038395 | Bacteria | 1015 |
| 66 | Ga0466657_069276 | 3300042582 | Bacteria | 1428 |
| 67 | Ga0466690_184728 | 3300042590 | Bacteria | 12894 |
| 68 | Ga0466696_225897 | 3300042596 | Bacteria | 5456 |
| 69 | Ga0466696_353546 | 3300042596 | Unclassified | 1079 |
| 70 | Ga0466707_263288 | 3300042601 | Bacteria | 7469 |
| 71 | Ga0466719_462111 | 3300042606 | Bacteria | 1535 |
| 72 | Ga0123353_10000212 | 3300010167 | Bacteria | 73953 |
| 73 | Ga0123357_10000986 | 3300009784 | Bacteria | 29038 |
| 74 | Ga0466712_060979 | 3300042614 | Bacteria | 2410 |
| 75 | Ga0466729_195256 | 3300042621 | Unclassified | 1844 |
| 76 | Ga0466734_043522 | 3300042623 | Bacteria | 48245 |
| 77 | Ga0466704_563673 | 3300042643 | Unclassified | 1748 |
| 78 | Ga0466708_056845 | 3300042652 | Bacteria | 7129 |
| 79 | Ga0160458_105373 | 3300012832 | Unclassified | 1524 |
| 80 | Ga0466657_185477 | 3300042582 | Bacteria | 8956 |
| 81 | Ga0466692_063852 | 3300042591 | Bacteria | 48253 |
| 82 | Ga0466691_156095 | 3300042593 | Bacteria | 1488 |
| 83 | Ga0466696_314327 | 3300042596 | Bacteria | 9435 |
| 84 | Ga0466719_261036 | 3300042606 | Bacteria | 5364 |
| 85 | Ga0466722_178715 | 3300042609 | Bacteria | 1684 |
| 86 | Ga0466726_381555 | 3300042619 | Bacteria | 2444 |
| 87 | Ga0466728_396827 | 3300042620 | Bacteria | 1182 |
| 88 | Ga0466734_027074 | 3300042623 | Bacteria | 12360 |
| 89 | Ga0466703_135809 | 3300042636 | Bacteria | 6557 |
| 90 | Ga0466704_245955 | 3300042643 | Bacteria | 17762 |
| 91 | Ga0466725_087144 | 3300042654 | Bacteria | 20893 |
| 92 | Ga0466657_007315 | 3300042582 | Bacteria | 17267 |
| 93 | Ga0466657_209290 | 3300042582 | Unclassified | 8337 |
| 94 | Ga0466716_050611 | 3300042605 | Bacteria | 3072 |
| 95 | Ga0466719_308745 | 3300042606 | Bacteria | 1087 |
| 96 | Ga0466722_026265 | 3300042609 | Bacteria | 38437 |
| 97 | Ga0466722_243141 | 3300042609 | Unclassified | 1196 |
| 98 | JGI24702J35022_10035210 | 3300002462 | Unclassified | 2677 |
| 99 | Ga0466711_328982 | 3300042615 | Bacteria | 6541 |
| 100 | Ga0466715_160211 | 3300042616 | Bacteria | 4695 |
| 101 | Ga0466718_068935 | 3300042617 | Bacteria | 3748 |
| 102 | Ga0466704_214878 | 3300042643 | Bacteria | 22593 |
| 103 | Ga0466708_248567 | 3300042652 | Bacteria | 16755 |
| 104 | Ga0466708_377934 | 3300042652 | Bacteria | 4134 |
| 105 | Ga0466705_352386 | 3300042612 | Bacteria | 63158 |
| 106 | Ga0160446_100832 | 3300012835 | Bacteria | 8889 |
| 107 | Ga0466692_086592 | 3300042591 | Bacteria | 6151 |
| 108 | Ga0466691_142404 | 3300042593 | Bacteria | 12701 |
| 109 | Ga0466696_154578 | 3300042596 | Bacteria | 1997 |
| 110 | Ga0466707_144122 | 3300042601 | Bacteria | 13340 |
| 111 | Ga0123354_10156775 | 3300010882 | Bacteria | 2727 |
| 112 | Ga0068302_10022712 | 3300005071 | Bacteria | 5309 |
| 113 | Ga0123357_10001859 | 3300009784 | Bacteria | 22924 |
| 114 | Ga0466710_402452 | 3300042613 | Bacteria | 1283 |
| 115 | Ga0466711_399986 | 3300042615 | Bacteria | 16613 |
| 116 | Ga0466729_232375 | 3300042621 | Bacteria | 60363 |
| 117 | Ga0466735_061280 | 3300042624 | Unclassified | 1185 |
| 118 | Ga0466702_236515 | 3300042635 | Bacteria | 2169 |
| 119 | Ga0466703_109797 | 3300042636 | Bacteria | 75110 |
| 120 | Ga0466703_229976 | 3300042636 | Bacteria | 14720 |
| 121 | Ga0466709_212043 | 3300042648 | Bacteria | 6840 |
| 122 | Ga0466725_113786 | 3300042654 | Bacteria | 19796 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.