Protein Family IF09999

Metagenome
112 Members
23 Samples
112 Scaffolds
140.85 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_374752|Ga0466708_374752_469_963
Length
164 aa
Sequence
MQTIMTTTHKVAALIPHGQYSATIEHIEAFEEALIRLEKQLERCPKLRETDGMKEHPAIFHYFCGATDIYICEFDGIDEMFGFTILNGDLYNAEWGYSSLSEIASIPVMNIDYYFEEQSIEAALYRQYPKHFKMPASLEKQCFLSPAVRRGYFPKPSAKRTAKE

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 52.2%
Termitidae 30.4%
Rhinotermitidae 8.7%
Termopsidae 8.7%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
4 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
5 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
6 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
7 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
14 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
17 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_001669 3300042612 Bacteria 4651
2 Ga0466705_165191 3300042612 Bacteria 1121
3 Ga0466735_125751 3300042624 Bacteria 2347
4 Ga0466704_378600 3300042643 Bacteria 1417
5 Ga0466704_389908 3300042643 Bacteria 1218
6 Ga0466704_432102 3300042643 Bacteria 2002
7 Ga0466704_455796 3300042643 Bacteria 1000
8 Ga0466704_485243 3300042643 Bacteria 1956
9 Ga0466709_051992 3300042648 Bacteria 1119
10 Ga0466709_055258 3300042648 Bacteria 5094
11 Ga0466727_153614 3300042655 Bacteria 2491
12 Ga0466716_028986 3300042605 Bacteria 1560
13 Ga0466656_242728 3300042550 Bacteria 1615
14 Ga0466694_063862 3300042594 Bacteria 1717
15 Ga0466696_189034 3300042596 Bacteria 1752
16 Ga0466705_506871 3300042612 Bacteria 3548
17 Ga0466711_299039 3300042615 Bacteria 1352
18 Ga0466715_611078 3300042616 Bacteria 3728
19 Ga0466723_092196 3300042618 Bacteria 2932
20 Ga0466723_173569 3300042618 Bacteria 3379
21 Ga0466728_058229 3300042620 Bacteria 1389
22 Ga0466735_024363 3300042624 Bacteria 13080
23 Ga0466704_117242 3300042643 Unclassified 3558
24 Ga0466709_192743 3300042648 Bacteria 2745
25 Ga0466708_187343 3300042652 Bacteria 2046
26 Ga0466690_224870 3300042590 Bacteria 12073
27 Ga0466715_431942 3300042616 Bacteria 2131
28 Ga0466723_348580 3300042618 Bacteria 1339
29 Ga0466728_021855 3300042620 Bacteria 2575
30 Ga0466704_195198 3300042643 Bacteria 2530
31 Ga0466704_412344 3300042643 Bacteria 1458
32 Ga0466704_592554 3300042643 Bacteria 1324
33 Ga0466708_014641 3300042652 Bacteria 1253
34 Ga0466708_171744 3300042652 Bacteria 1150
35 Ga0466692_019516 3300042591 Bacteria 1913
36 Ga0466695_054104 3300042595 Bacteria 12771
37 Ga0466723_034997 3300042618 Bacteria 1001
38 Ga0466729_043532 3300042621 Bacteria 1080
39 Ga0466729_083692 3300042621 Bacteria 3987
40 Ga0466705_196177 3300042612 Bacteria 1721
41 Ga0466703_063958 3300042636 Bacteria 7297
42 Ga0466709_246369 3300042648 Bacteria 2988
43 Ga0466709_377191 3300042648 Bacteria 2966
44 Ga0466727_068422 3300042655 Bacteria 1652
45 JGI24702J35022_10036865 3300002462 Bacteria 2613
46 Ga0466657_058258 3300042582 Bacteria 1318
47 Ga0466695_295910 3300042595 Bacteria 4875
48 Ga0466711_207981 3300042615 Bacteria 2581
49 Ga0466705_166304 3300042612 Bacteria 1180
50 Ga0466705_182030 3300042612 Bacteria 3576
51 Ga0466731_356465 3300042622 Bacteria 1403
52 Ga0466704_479998 3300042643 Bacteria 1696
53 Ga0466709_019057 3300042648 Bacteria 1739
54 Ga0466709_033611 3300042648 Bacteria 4264
55 Ga0466709_111703 3300042648 Bacteria 10899
56 Ga0466709_139021 3300042648 Bacteria 1234
57 Ga0466709_175560 3300042648 Unclassified 2370
58 Ga0466709_334858 3300042648 Bacteria 1082
59 Ga0466708_081468 3300042652 Bacteria 1304
60 Ga0466708_086954 3300042652 Bacteria 1226
61 Ga0466727_272540 3300042655 Bacteria 1323
62 Ga0466716_300337 3300042605 Bacteria 5063
63 Ga0466705_507425 3300042612 Bacteria 1557
64 Ga0466711_274568 3300042615 Bacteria 1826
65 Ga0466723_060344 3300042618 Bacteria 2068
66 Ga0466723_175026 3300042618 Bacteria 5158
67 Ga0466723_243058 3300042618 Bacteria 2831
68 Ga0466705_020983 3300042612 Bacteria 5568
69 Ga0466705_147836 3300042612 Bacteria 7987
70 Ga0466705_172977 3300042612 Bacteria 1838
71 Ga0466703_125268 3300042636 Bacteria 3396
72 Ga0466704_094616 3300042643 Bacteria 1142
73 Ga0466704_160480 3300042643 Bacteria 1777
74 Ga0466704_448317 3300042643 Bacteria 1498
75 Ga0466709_090280 3300042648 Bacteria 1551
76 Ga0466709_154300 3300042648 Bacteria 1346
77 Ga0466709_320210 3300042648 Bacteria 2077
78 Ga0466708_111570 3300042652 Unclassified 3384
79 Ga0466708_374752 3300042652 Bacteria 1631
80 Ga0466727_074308 3300042655 Bacteria 2372
81 Ga0466700_269382 3300042600 Bacteria 2589
82 Ga0466696_014637 3300042596 Bacteria 1894
83 Ga0466705_389610 3300042612 Bacteria 1768
84 Ga0466705_462922 3300042612 Bacteria 1761
85 Ga0466705_501587 3300042612 Bacteria 1646
86 Ga0466715_250341 3300042616 Bacteria 1854
87 Ga0466723_062645 3300042618 Bacteria 5114
88 Ga0466723_208612 3300042618 Bacteria 1202
89 Ga0466705_038634 3300042612 Unclassified 8765
90 Ga0466705_046462 3300042612 Bacteria 10571
91 Ga0466703_396869 3300042636 Bacteria 1812
92 Ga0466704_004405 3300042643 Bacteria 1039
93 Ga0466704_256259 3300042643 Bacteria 1505
94 Ga0466704_263091 3300042643 Unclassified 2136
95 Ga0466708_136731 3300042652 Bacteria 2015
96 Ga0466716_117571 3300042605 Bacteria 2891
97 Ga0466716_276760 3300042605 Bacteria 1152
98 Ga0466696_266167 3300042596 Bacteria 1782
99 Ga0466715_371642 3300042616 Bacteria 5415
100 Ga0466728_403038 3300042620 Bacteria 1530
101 Ga0466705_145359 3300042612 Bacteria 1350
102 Ga0466705_329154 3300042612 Bacteria 7664
103 Ga0466731_245099 3300042622 Bacteria 1031
104 Ga0466704_106709 3300042643 Bacteria 1076
105 Ga0466704_267619 3300042643 Bacteria 1007
106 Ga0466709_079259 3300042648 Bacteria 24652
107 Ga0466708_042128 3300042652 Bacteria 5428
108 Ga0466690_201389 3300042590 Bacteria 1307
109 Ga0466690_337471 3300042590 Bacteria 11749
110 Ga0466723_105164 3300042618 Bacteria 1027
111 Ga0466723_109874 3300042618 Bacteria 13022
112 Ga0466723_137629 3300042618 Bacteria 1881

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042621 Ga0466729_043532 Ga0466729_043532_24_443 126
2 3300042648 Ga0466709_154300 Ga0466709_154300_939_1331 130
3 3300042655 Ga0466727_068422 Ga0466727_068422_458_880 131
4 3300042648 Ga0466709_079259 Ga0466709_079259_2146_2553 135
5 3300042652 Ga0466708_111570 Ga0466708_111570_2637_3044 135
6 3300042652 Ga0466708_187343 Ga0466708_187343_1079_1486 135
7 3300042605 Ga0466716_117571 Ga0466716_117571_1574_1984 136
8 3300042618 Ga0466723_348580 Ga0466723_348580_55_465 136
9 3300042643 Ga0466704_432102 Ga0466704_432102_143_553 136
10 3300042643 Ga0466704_592554 Ga0466704_592554_846_1271 136
11 3300042615 Ga0466711_274568 Ga0466711_274568_300_713 137
12 3300042596 Ga0466696_266167 Ga0466696_266167_927_1343 138
13 3300042612 Ga0466705_182030 Ga0466705_182030_1889_2326 138
14 3300042612 Ga0466705_196177 Ga0466705_196177_482_898 138
15 3300042550 Ga0466656_242728 Ga0466656_242728_761_1180 139
16 3300042582 Ga0466657_058258 Ga0466657_058258_643_1062 139
17 3300042591 Ga0466692_019516 Ga0466692_019516_877_1329 139
18 3300042618 Ga0466723_092196 Ga0466723_092196_2179_2598 139
19 3300042652 Ga0466708_042128 Ga0466708_042128_4619_5038 139
20 3300042590 Ga0466690_201389 Ga0466690_201389_126_548 140
21 3300042590 Ga0466690_224870 Ga0466690_224870_4047_4469 140
22 3300042590 Ga0466690_337471 Ga0466690_337471_196_618 140
23 3300042594 Ga0466694_063862 Ga0466694_063862_316_738 140
24 3300042605 Ga0466716_028986 Ga0466716_028986_111_533 140
25 3300042605 Ga0466716_276760 Ga0466716_276760_267_689 140
26 3300042605 Ga0466716_300337 Ga0466716_300337_3377_3799 140
27 3300042612 Ga0466705_001669 Ga0466705_001669_3030_3452 140
28 3300042612 Ga0466705_020983 Ga0466705_020983_200_622 140
29 3300042612 Ga0466705_046462 Ga0466705_046462_252_674 140
30 3300042612 Ga0466705_145359 Ga0466705_145359_521_943 140
31 3300042612 Ga0466705_147836 Ga0466705_147836_490_912 140
32 3300042612 Ga0466705_165191 Ga0466705_165191_529_951 140
33 3300042612 Ga0466705_166304 Ga0466705_166304_687_1109 140
34 3300042612 Ga0466705_329154 Ga0466705_329154_7153_7575 140
35 3300042612 Ga0466705_389610 Ga0466705_389610_1035_1457 140
36 3300042612 Ga0466705_501587 Ga0466705_501587_166_588 140
37 3300042612 Ga0466705_506871 Ga0466705_506871_2471_2893 140
38 3300042616 Ga0466715_250341 Ga0466715_250341_972_1394 140
39 3300042616 Ga0466715_371642 Ga0466715_371642_1813_2235 140
40 3300042616 Ga0466715_431942 Ga0466715_431942_246_668 140
41 3300042616 Ga0466715_611078 Ga0466715_611078_1428_1850 140
42 3300042618 Ga0466723_060344 Ga0466723_060344_872_1294 140
43 3300042618 Ga0466723_062645 Ga0466723_062645_3726_4148 140
44 3300042618 Ga0466723_137629 Ga0466723_137629_1210_1632 140
45 3300042618 Ga0466723_173569 Ga0466723_173569_1569_1991 140
46 3300042618 Ga0466723_175026 Ga0466723_175026_52_474 140
47 3300042618 Ga0466723_208612 Ga0466723_208612_409_831 140
48 3300042618 Ga0466723_243058 Ga0466723_243058_2179_2601 140
49 3300042620 Ga0466728_058229 Ga0466728_058229_152_574 140
50 3300042620 Ga0466728_403038 Ga0466728_403038_180_602 140
51 3300042624 Ga0466735_024363 Ga0466735_024363_2195_2617 140
52 3300042624 Ga0466735_125751 Ga0466735_125751_1348_1770 140
53 3300042636 Ga0466703_063958 Ga0466703_063958_1315_1737 140
54 3300042636 Ga0466703_396869 Ga0466703_396869_988_1410 140
55 3300042643 Ga0466704_004405 Ga0466704_004405_328_750 140
56 3300042643 Ga0466704_094616 Ga0466704_094616_306_728 140
57 3300042643 Ga0466704_106709 Ga0466704_106709_307_729 140
58 3300042643 Ga0466704_117242 Ga0466704_117242_2681_3103 140
59 3300042643 Ga0466704_195198 Ga0466704_195198_801_1223 140
60 3300042643 Ga0466704_256259 Ga0466704_256259_14_436 140
61 3300042643 Ga0466704_263091 Ga0466704_263091_709_1131 140
62 3300042643 Ga0466704_267619 Ga0466704_267619_501_923 140
63 3300042643 Ga0466704_378600 Ga0466704_378600_858_1280 140
64 3300042643 Ga0466704_389908 Ga0466704_389908_260_682 140
65 3300042643 Ga0466704_412344 Ga0466704_412344_847_1269 140
66 3300042643 Ga0466704_448317 Ga0466704_448317_504_926 140
67 3300042643 Ga0466704_479998 Ga0466704_479998_1224_1646 140
68 3300042643 Ga0466704_485243 Ga0466704_485243_952_1374 140
69 3300042648 Ga0466709_019057 Ga0466709_019057_140_562 140
70 3300042648 Ga0466709_051992 Ga0466709_051992_387_809 140
71 3300042648 Ga0466709_090280 Ga0466709_090280_455_877 140
72 3300042648 Ga0466709_111703 Ga0466709_111703_3345_3767 140
73 3300042648 Ga0466709_175560 Ga0466709_175560_1312_1734 140
74 3300042648 Ga0466709_192743 Ga0466709_192743_1993_2415 140
75 3300042648 Ga0466709_246369 Ga0466709_246369_1745_2167 140
76 3300042648 Ga0466709_320210 Ga0466709_320210_1266_1688 140
77 3300042648 Ga0466709_334858 Ga0466709_334858_224_646 140
78 3300042648 Ga0466709_377191 Ga0466709_377191_1367_1789 140
79 3300042652 Ga0466708_014641 Ga0466708_014641_235_657 140
80 3300042652 Ga0466708_136731 Ga0466708_136731_489_911 140
81 3300042652 Ga0466708_171744 Ga0466708_171744_462_884 140
82 3300042655 Ga0466727_074308 Ga0466727_074308_678_1100 140
83 3300042655 Ga0466727_153614 Ga0466727_153614_276_698 140
84 3300042655 Ga0466727_272540 Ga0466727_272540_808_1230 140
85 3300042596 Ga0466696_189034 Ga0466696_189034_382_807 141
86 3300042612 Ga0466705_462922 Ga0466705_462922_772_1197 141
87 3300042615 Ga0466711_299039 Ga0466711_299039_663_1088 141
88 3300042618 Ga0466723_034997 Ga0466723_034997_61_486 141
89 3300042636 Ga0466703_125268 Ga0466703_125268_1449_1874 141
90 3300042643 Ga0466704_160480 Ga0466704_160480_673_1098 141
91 3300042652 Ga0466708_086954 Ga0466708_086954_409_837 142
92 3300042595 Ga0466695_054104 Ga0466695_054104_426_857 143
93 3300042600 Ga0466700_269382 Ga0466700_269382_1357_1788 143
94 3300042612 Ga0466705_038634 Ga0466705_038634_7286_7717 143
95 3300042622 Ga0466731_245099 Ga0466731_245099_137_568 143
96 3300042622 Ga0466731_356465 Ga0466731_356465_341_772 143
97 3300002462 JGI24702J35022_10036865 JGI24702J35022_100368653 145
98 3300042596 Ga0466696_014637 Ga0466696_014637_355_792 145
99 3300042612 Ga0466705_172977 Ga0466705_172977_730_1167 145
100 3300042618 Ga0466723_105164 Ga0466723_105164_19_456 145
101 3300042620 Ga0466728_021855 Ga0466728_021855_525_962 145
102 3300042621 Ga0466729_083692 Ga0466729_083692_2943_3380 145
103 3300042648 Ga0466709_033611 Ga0466709_033611_2905_3342 145
104 3300042648 Ga0466709_055258 Ga0466709_055258_3299_3736 145
105 3300042648 Ga0466709_139021 Ga0466709_139021_481_918 145
106 3300042615 Ga0466711_207981 Ga0466711_207981_302_751 149
107 3300042643 Ga0466704_455796 Ga0466704_455796_428_880 150
108 3300042652 Ga0466708_081468 Ga0466708_081468_813_1274 153
109 3300042595 Ga0466695_295910 Ga0466695_295910_66_530 154
110 3300042612 Ga0466705_507425 Ga0466705_507425_265_735 156
111 3300042618 Ga0466723_109874 Ga0466723_109874_560_1039 159
112 3300042652 Ga0466708_374752 Ga0466708_374752_469_963 164

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.