Protein Family IF09921
Metagenome
Metatranscriptome
Isolate
348
Members
69
Samples
337
Scaffolds
240.78
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_178237|Ga0466708_178237_1749_2555
- Length
- 268 aa
- Sequence
- MMAMNWQIRNGYRSSGMPLPIMVKGGSYMKRYVFVLVIVGLAGFLSAQQNEIGSTDAERLGVDTAQQKLKEISIEKFEHEGYWRSSISSDTGYSTTRLFAGGPAGKEPVEDEQDLNIPDQYVLGTRVDFLRRGHTSFTLYPNRPIPIEGIAKTVSVWVAGRNFNHTLSLLIEDYFDRTYELYVGKLNFQGWKRMAVSIPQQADDGLHGIVQRNYHYNNQMGIKIVGLRIDCDPMEAMGSYYVYFDDLRAVTDLFAEDYRDPDDMIDTW
Sample Types
Isolate
3.2%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
2.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Kalotermitidae
21.2%
Unclassified
19.7%
Termopsidae
6.1%
Rhinotermitidae
4.5%
Blaberidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
1
Bacteria
325
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 2 | 3300021238 | Termite gut microbial communities from nest - French Guiana - 6_6 mRNA SA | Metatranscriptome | Termitidae |
| 3 | 3300021240 | Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA | Metatranscriptome | Termitidae |
| 4 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 5 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 6 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 21 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 22 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 23 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 24 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 25 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 26 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 27 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 28 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
| 29 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 45 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 51 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 52 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 55 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 56 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 57 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 58 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 59 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 60 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 61 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 62 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 63 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 64 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 65 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 66 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 67 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 68 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 69 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_245856 | 3300042615 | Bacteria | 36243 |
| 2 | Ga0466715_061891 | 3300042616 | Bacteria | 11846 |
| 3 | Ga0466715_206361 | 3300042616 | Bacteria | 12461 |
| 4 | Ga0466715_219506 | 3300042616 | Bacteria | 24580 |
| 5 | Ga0466723_300287 | 3300042618 | Bacteria | 3238 |
| 6 | Ga0466726_127759 | 3300042619 | Bacteria | 20118 |
| 7 | Ga0466726_127833 | 3300042619 | Bacteria | 23584 |
| 8 | Ga0123357_10075832 | 3300009784 | Bacteria | 4444 |
| 9 | Ga0123357_10145065 | 3300009784 | Bacteria | 2903 |
| 10 | Ga0123356_10000512 | 3300010049 | Bacteria | 43209 |
| 11 | Ga0223688_1015053 | 3300021227 | Bacteria | 921 |
| 12 | Ga0223686_1003423 | 3300021244 | Bacteria | 825 |
| 13 | Ga0415639_008205 | 3300038395 | Bacteria | 3792 |
| 14 | Ga0415639_058188 | 3300038395 | Unclassified | 9699 |
| 15 | Ga0466690_091262 | 3300042590 | Bacteria | 1654 |
| 16 | Ga0466690_220888 | 3300042590 | Bacteria | 4742 |
| 17 | Ga0466691_089756 | 3300042593 | Bacteria | 7175 |
| 18 | Ga0466695_218885 | 3300042595 | Bacteria | 1269 |
| 19 | Ga0466696_362874 | 3300042596 | Bacteria | 2034 |
| 20 | JGI24705J35276_12202333 | 3300002504 | Bacteria | 1635 |
| 21 | Ga0068305_10459418 | 3300005083 | Bacteria | 1069 |
| 22 | Ga0072941_1002871 | 3300005201 | Bacteria | 36049 |
| 23 | Ga0466735_073372 | 3300042624 | Bacteria | 1605 |
| 24 | Ga0466735_159420 | 3300042624 | Bacteria | 1558 |
| 25 | Ga0466703_081404 | 3300042636 | Bacteria | 1954 |
| 26 | Ga0466703_320516 | 3300042636 | Bacteria | 6562 |
| 27 | Ga0466704_376808 | 3300042643 | Bacteria | 11222 |
| 28 | Ga0466709_130608 | 3300042648 | Bacteria | 7106 |
| 29 | Ga0466708_178237 | 3300042652 | Bacteria | 5028 |
| 30 | Ga0466708_222825 | 3300042652 | Bacteria | 10205 |
| 31 | Ga0466727_107037 | 3300042655 | Bacteria | 3936 |
| 32 | Ga0466727_217070 | 3300042655 | Bacteria | 2266 |
| 33 | Ga0466727_328835 | 3300042655 | Bacteria | 2371 |
| 34 | Ga0466706_080058 | 3300042599 | Bacteria | 4197 |
| 35 | Ga0466707_106209 | 3300042601 | Bacteria | 2194 |
| 36 | Ga0466716_350354 | 3300042605 | Unclassified | 2828 |
| 37 | Ga0466722_007964 | 3300042609 | Bacteria | 3822 |
| 38 | Ga0466722_107335 | 3300042609 | Bacteria | 4920 |
| 39 | Ga0466705_175955 | 3300042612 | Bacteria | 1965 |
| 40 | Ga0466732_313872 | 3300042656 | Bacteria | 2669 |
| 41 | Ga0466733_050180 | 3300042659 | Bacteria | 1332 |
| 42 | Ga0466705_412005 | 3300042612 | Bacteria | 4613 |
| 43 | Ga0466711_183178 | 3300042615 | Bacteria | 53190 |
| 44 | Ga0466711_194976 | 3300042615 | Bacteria | 21215 |
| 45 | Ga0466715_008605 | 3300042616 | Bacteria | 8134 |
| 46 | Ga0466715_428589 | 3300042616 | Bacteria | 8952 |
| 47 | Ga0466718_052483 | 3300042617 | Bacteria | 8601 |
| 48 | Ga0466718_096101 | 3300042617 | Bacteria | 10943 |
| 49 | Ga0466726_292745 | 3300042619 | Bacteria | 2882 |
| 50 | Ga0466726_388027 | 3300042619 | Bacteria | 1288 |
| 51 | Ga0466728_027336 | 3300042620 | Bacteria | 21574 |
| 52 | Ga0466728_103065 | 3300042620 | Bacteria | 11635 |
| 53 | Ga0466728_133928 | 3300042620 | Bacteria | 8158 |
| 54 | Ga0466729_011889 | 3300042621 | Bacteria | 2321 |
| 55 | Ga0223674_1003344 | 3300021235 | Bacteria | 1443 |
| 56 | Ga0223681_1009418 | 3300021238 | Bacteria | 1676 |
| 57 | Ga0264413_138803 | 3300024493 | Bacteria | 1794 |
| 58 | Ga0466691_034660 | 3300042593 | Bacteria | 57357 |
| 59 | Ga0466691_135702 | 3300042593 | Bacteria | 3255 |
| 60 | Ga0466694_033385 | 3300042594 | Bacteria | 4075 |
| 61 | Ga0466694_036318 | 3300042594 | Bacteria | 1430 |
| 62 | Ga0466694_068724 | 3300042594 | Bacteria | 15512 |
| 63 | Ga0466696_423691 | 3300042596 | Bacteria | 31979 |
| 64 | AustNasuHG_c1026499 | 3300000089 | Bacteria | 1804 |
| 65 | JGI24695J34938_10000812 | 3300002450 | Bacteria | 29016 |
| 66 | JGI24695J34938_10004796 | 3300002450 | Bacteria | 8701 |
| 67 | Ga0072940_1029445 | 3300005200 | Bacteria | 6480 |
| 68 | Ga0072941_1002621 | 3300005201 | Bacteria | 76805 |
| 69 | Ga0072941_1017331 | 3300005201 | Bacteria | 25015 |
| 70 | Ga0072941_1037232 | 3300005201 | Unclassified | 2707 |
| 71 | Ga0466735_068640 | 3300042624 | Bacteria | 1386 |
| 72 | Ga0466735_173767 | 3300042624 | Unclassified | 3033 |
| 73 | Ga0466703_049531 | 3300042636 | Bacteria | 42822 |
| 74 | Ga0466703_066761 | 3300042636 | Bacteria | 16921 |
| 75 | Ga0466704_163988 | 3300042643 | Bacteria | 31139 |
| 76 | Ga0466704_254754 | 3300042643 | Bacteria | 10057 |
| 77 | Ga0466704_447125 | 3300042643 | Bacteria | 2503 |
| 78 | Ga0466708_042865 | 3300042652 | Bacteria | 1929 |
| 79 | Ga0466727_190564 | 3300042655 | Bacteria | 2172 |
| 80 | Ga0466700_467557 | 3300042600 | Bacteria | 1824 |
| 81 | Ga0466707_324435 | 3300042601 | Unclassified | 1554 |
| 82 | Ga0466717_296609 | 3300042604 | Bacteria | 1190 |
| 83 | Ga0466716_042368 | 3300042605 | Bacteria | 28535 |
| 84 | Ga0466716_321738 | 3300042605 | Unclassified | 5148 |
| 85 | Ga0466722_031137 | 3300042609 | Bacteria | 30564 |
| 86 | Ga0466698_299638 | 3300042610 | Bacteria | 1745 |
| 87 | Ga0466698_300846 | 3300042610 | Bacteria | 1529 |
| 88 | Ga0466705_434198 | 3300042612 | Bacteria | 5999 |
| 89 | Ga0466712_019586 | 3300042614 | Bacteria | 4130 |
| 90 | Ga0466712_210893 | 3300042614 | Bacteria | 3300 |
| 91 | Ga0466711_053857 | 3300042615 | Bacteria | 7625 |
| 92 | Ga0466715_139361 | 3300042616 | Bacteria | 13505 |
| 93 | Ga0466715_378445 | 3300042616 | Bacteria | 22162 |
| 94 | Ga0466715_382699 | 3300042616 | Bacteria | 3295 |
| 95 | Ga0466718_069328 | 3300042617 | Bacteria | 45967 |
| 96 | Ga0466718_146517 | 3300042617 | Bacteria | 2767 |
| 97 | Ga0466718_168474 | 3300042617 | Bacteria | 5238 |
| 98 | Ga0466726_138882 | 3300042619 | Bacteria | 1614 |
| 99 | Ga0466726_147531 | 3300042619 | Unclassified | 4620 |
| 100 | Ga0466726_339963 | 3300042619 | Bacteria | 2007 |
| 101 | Ga0466726_350718 | 3300042619 | Bacteria | 5629 |
| 102 | Ga0466726_410524 | 3300042619 | Bacteria | 1174 |
| 103 | Ga0466728_285152 | 3300042620 | Bacteria | 4178 |
| 104 | Ga0123356_10089855 | 3300010049 | Bacteria | 2923 |
| 105 | Ga0123353_10160132 | 3300010167 | Bacteria | 3584 |
| 106 | Ga0233288_1002888 | 3300022232 | Bacteria | 1976 |
| 107 | Ga0466690_163093 | 3300042590 | Bacteria | 1891 |
| 108 | Ga0466691_088476 | 3300042593 | Bacteria | 8636 |
| 109 | Ga0466696_004288 | 3300042596 | Bacteria | 1221 |
| 110 | Ga0466696_316939 | 3300042596 | Bacteria | 1766 |
| 111 | Ga0466699_078559 | 3300042597 | Bacteria | 1338 |
| 112 | JGI24695J34938_10041436 | 3300002450 | Unclassified | 2067 |
| 113 | JGI24702J35022_10003430 | 3300002462 | Bacteria | 9554 |
| 114 | Ga0072941_1034986 | 3300005201 | Bacteria | 6020 |
| 115 | Ga0466702_222895 | 3300042635 | Bacteria | 1394 |
| 116 | Ga0466704_087741 | 3300042643 | Bacteria | 5393 |
| 117 | Ga0466709_340399 | 3300042648 | Bacteria | 46536 |
| 118 | Ga0466708_068830 | 3300042652 | Bacteria | 16777 |
| 119 | Ga0466708_106051 | 3300042652 | Bacteria | 43878 |
| 120 | Ga0466708_119101 | 3300042652 | Unclassified | 1208 |
| 121 | Ga0466727_264848 | 3300042655 | Unclassified | 1252 |
| 122 | Ga0466707_167985 | 3300042601 | Bacteria | 2539 |
| 123 | Ga0466716_407472 | 3300042605 | Bacteria | 3290 |
| 124 | Ga0466716_490358 | 3300042605 | Bacteria | 2909 |
| 125 | Ga0466716_508393 | 3300042605 | Bacteria | 1367 |
| 126 | Ga0466719_084613 | 3300042606 | Bacteria | 14565 |
| 127 | Ga0466733_137487 | 3300042659 | Bacteria | 6067 |
| 128 | Ga0466711_101381 | 3300042615 | Bacteria | 1878 |
| 129 | Ga0466711_152246 | 3300042615 | Bacteria | 13864 |
| 130 | Ga0466711_227656 | 3300042615 | Bacteria | 30590 |
| 131 | Ga0466726_452737 | 3300042619 | Bacteria | 1986 |
| 132 | Ga0123357_10153452 | 3300009784 | Bacteria | 2786 |
| 133 | Ga0123353_10648062 | 3300010167 | Bacteria | 1496 |
| 134 | Ga0255809_1032078 | 3300022820 | Bacteria | 1768 |
| 135 | Ga0466690_149509 | 3300042590 | Bacteria | 5748 |
| 136 | Ga0466690_389100 | 3300042590 | Bacteria | 1911 |
| 137 | Ga0466691_044793 | 3300042593 | Bacteria | 3206 |
| 138 | Ga0466694_051488 | 3300042594 | Bacteria | 2512 |
| 139 | Ga0466696_180220 | 3300042596 | Bacteria | 6308 |
| 140 | Ga0466696_441561 | 3300042596 | Bacteria | 1270 |
| 141 | JGI24698J34947_10003716 | 3300002449 | Unclassified | 8298 |
| 142 | JGI24698J34947_10025591 | 3300002449 | Bacteria | 3140 |
| 143 | JGI24695J34938_10000443 | 3300002450 | Bacteria | 40027 |
| 144 | JGI24695J34938_10022471 | 3300002450 | Unclassified | 3062 |
| 145 | JGI24695J34938_10052024 | 3300002450 | Bacteria | 1788 |
| 146 | JGI24702J35022_10012081 | 3300002462 | Bacteria | 4806 |
| 147 | Ga0072941_1002620 | 3300005201 | Bacteria | 23255 |
| 148 | Ga0072941_1017449 | 3300005201 | Bacteria | 1394 |
| 149 | Ga0466734_023269 | 3300042623 | Bacteria | 1131 |
| 150 | Ga0466703_028455 | 3300042636 | Bacteria | 9999 |
| 151 | Ga0466727_287321 | 3300042655 | Unclassified | 1853 |
| 152 | Ga0466727_289756 | 3300042655 | Bacteria | 3269 |
| 153 | Ga0466707_392817 | 3300042601 | Bacteria | 1158 |
| 154 | Ga0466713_026184 | 3300042602 | Unclassified | 3337 |
| 155 | Ga0466717_228432 | 3300042604 | Bacteria | 1127 |
| 156 | Ga0466716_043061 | 3300042605 | Bacteria | 6702 |
| 157 | Ga0466716_536308 | 3300042605 | Bacteria | 1824 |
| 158 | Ga0466719_224458 | 3300042606 | Bacteria | 9542 |
| 159 | Ga0466719_549503 | 3300042606 | Bacteria | 4951 |
| 160 | Ga0466720_096599 | 3300042607 | Bacteria | 2396 |
| 161 | Ga0466722_165629 | 3300042609 | Bacteria | 4249 |
| 162 | Ga0466705_119603 | 3300042612 | Bacteria | 10660 |
| 163 | Ga0466733_095652 | 3300042659 | Bacteria | 1942 |
| 164 | Ga0466712_008276 | 3300042614 | Bacteria | 3014 |
| 165 | Ga0466712_014889 | 3300042614 | Bacteria | 58641 |
| 166 | Ga0466711_417246 | 3300042615 | Bacteria | 4997 |
| 167 | Ga0466715_201665 | 3300042616 | Bacteria | 3558 |
| 168 | Ga0466718_086521 | 3300042617 | Bacteria | 8058 |
| 169 | Ga0466723_023439 | 3300042618 | Bacteria | 9733 |
| 170 | Ga0466723_071057 | 3300042618 | Bacteria | 3603 |
| 171 | Ga0466723_149042 | 3300042618 | Bacteria | 10637 |
| 172 | Ga0466723_255771 | 3300042618 | Bacteria | 84056 |
| 173 | Ga0466726_209862 | 3300042619 | Bacteria | 5527 |
| 174 | Ga0466728_278255 | 3300042620 | Bacteria | 4818 |
| 175 | Ga0466728_415740 | 3300042620 | Bacteria | 20737 |
| 176 | Ga0264413_148610 | 3300024493 | Unclassified | 1522 |
| 177 | Ga0466691_068316 | 3300042593 | Bacteria | 35532 |
| 178 | Ga0466691_189382 | 3300042593 | Bacteria | 2942 |
| 179 | Ga0466694_105860 | 3300042594 | Bacteria | 1632 |
| 180 | Ga0466696_198424 | 3300042596 | Bacteria | 2338 |
| 181 | Ga0072941_1002622 | 3300005201 | Bacteria | 39237 |
| 182 | Ga0072941_1004442 | 3300005201 | Bacteria | 4600 |
| 183 | Ga0466703_097986 | 3300042636 | Bacteria | 3003 |
| 184 | Ga0466703_409321 | 3300042636 | Bacteria | 56299 |
| 185 | Ga0466704_268117 | 3300042643 | Bacteria | 56383 |
| 186 | Ga0466704_335796 | 3300042643 | Bacteria | 67702 |
| 187 | Ga0466708_020436 | 3300042652 | Bacteria | 28392 |
| 188 | Ga0466708_126403 | 3300042652 | Bacteria | 9600 |
| 189 | Ga0466708_358848 | 3300042652 | Unclassified | 1082 |
| 190 | Ga0466708_364701 | 3300042652 | Bacteria | 4287 |
| 191 | Ga0466708_455563 | 3300042652 | Bacteria | 2808 |
| 192 | Ga0466706_252646 | 3300042599 | Bacteria | 4009 |
| 193 | Ga0466700_322761 | 3300042600 | Bacteria | 1544 |
| 194 | Ga0466716_095352 | 3300042605 | Bacteria | 7897 |
| 195 | Ga0466716_165503 | 3300042605 | Bacteria | 4706 |
| 196 | Ga0466716_286925 | 3300042605 | Bacteria | 11915 |
| 197 | Ga0466716_383398 | 3300042605 | Bacteria | 1409 |
| 198 | Ga0466719_048637 | 3300042606 | Bacteria | 10963 |
| 199 | Ga0466719_124011 | 3300042606 | Bacteria | 66542 |
| 200 | Ga0466719_347153 | 3300042606 | Bacteria | 4026 |
| 201 | Ga0466722_040736 | 3300042609 | Bacteria | 50466 |
| 202 | Ga0466705_139565 | 3300042612 | Bacteria | 22615 |
| 203 | Ga0466705_271225 | 3300042612 | Bacteria | 3560 |
| 204 | Ga0466732_151253 | 3300042656 | Bacteria | 4143 |
| 205 | Ga0466732_397348 | 3300042656 | Bacteria | 1145 |
| 206 | Ga0466712_148519 | 3300042614 | Bacteria | 7403 |
| 207 | Ga0466715_270326 | 3300042616 | Bacteria | 2993 |
| 208 | Ga0466715_355876 | 3300042616 | Bacteria | 7896 |
| 209 | Ga0466723_148519 | 3300042618 | Bacteria | 15080 |
| 210 | Ga0466723_318907 | 3300042618 | Bacteria | 3991 |
| 211 | Ga0466723_333394 | 3300042618 | Bacteria | 4006 |
| 212 | Ga0466726_076007 | 3300042619 | Bacteria | 7700 |
| 213 | Ga0466726_437405 | 3300042619 | Bacteria | 4506 |
| 214 | Ga0466726_480256 | 3300042619 | Bacteria | 1828 |
| 215 | Ga0466728_205385 | 3300042620 | Bacteria | 18568 |
| 216 | Ga0123356_10014673 | 3300010049 | Bacteria | 7529 |
| 217 | Ga0223684_1019796 | 3300021240 | Bacteria | 985 |
| 218 | Ga0264413_101302 | 3300024493 | Bacteria | 8738 |
| 219 | Ga0466690_160998 | 3300042590 | Bacteria | 1118 |
| 220 | Ga0466692_029014 | 3300042591 | Bacteria | 31809 |
| 221 | Ga0466692_056617 | 3300042591 | Bacteria | 76518 |
| 222 | Ga0466691_079615 | 3300042593 | Bacteria | 1866 |
| 223 | Ga0466696_241002 | 3300042596 | Bacteria | 5849 |
| 224 | Ga0466699_252757 | 3300042597 | Unclassified | 1212 |
| 225 | JGI24698J34947_10000431 | 3300002449 | Bacteria | 19275 |
| 226 | JGI24695J34938_10000389 | 3300002450 | Bacteria | 43422 |
| 227 | Ga0466703_169297 | 3300042636 | Bacteria | 8796 |
| 228 | Ga0466703_423008 | 3300042636 | Bacteria | 2173 |
| 229 | Ga0466704_276267 | 3300042643 | Bacteria | 3472 |
| 230 | Ga0466704_302707 | 3300042643 | Bacteria | 8155 |
| 231 | Ga0466704_305606 | 3300042643 | Bacteria | 29402 |
| 232 | Ga0466709_023504 | 3300042648 | Bacteria | 5990 |
| 233 | Ga0466709_037149 | 3300042648 | Bacteria | 7810 |
| 234 | Ga0466709_379463 | 3300042648 | Bacteria | 15072 |
| 235 | Ga0466708_106672 | 3300042652 | Bacteria | 1282 |
| 236 | Ga0466708_308937 | 3300042652 | Bacteria | 19894 |
| 237 | Ga0466708_456071 | 3300042652 | Bacteria | 2806 |
| 238 | Ga0466708_459175 | 3300042652 | Bacteria | 9845 |
| 239 | Ga0466727_081080 | 3300042655 | Bacteria | 1455 |
| 240 | Ga0466727_205103 | 3300042655 | Archaea | 1413 |
| 241 | Ga0466716_201114 | 3300042605 | Bacteria | 39030 |
| 242 | Ga0466719_214943 | 3300042606 | Bacteria | 15359 |
| 243 | Ga0466719_561114 | 3300042606 | Bacteria | 23121 |
| 244 | Ga0466722_082964 | 3300042609 | Bacteria | 56291 |
| 245 | Ga0466722_111329 | 3300042609 | Bacteria | 11935 |
| 246 | Ga0466722_226287 | 3300042609 | Bacteria | 2092 |
| 247 | Ga0466705_108792 | 3300042612 | Bacteria | 41615 |
| 248 | Ga0466705_259831 | 3300042612 | Bacteria | 5243 |
| 249 | Ga0466732_405707 | 3300042656 | Bacteria | 1250 |
| 250 | Ga0466715_063066 | 3300042616 | Bacteria | 49420 |
| 251 | Ga0466718_016758 | 3300042617 | Bacteria | 6376 |
| 252 | Ga0466718_064199 | 3300042617 | Bacteria | 8827 |
| 253 | Ga0466723_291250 | 3300042618 | Bacteria | 3078 |
| 254 | Ga0466726_220562 | 3300042619 | Bacteria | 1507 |
| 255 | Ga0466726_310659 | 3300042619 | Bacteria | 1171 |
| 256 | Ga0466726_352406 | 3300042619 | Bacteria | 1825 |
| 257 | Ga0466726_380655 | 3300042619 | Bacteria | 2220 |
| 258 | Ga0466726_414555 | 3300042619 | Bacteria | 7296 |
| 259 | Ga0466726_487350 | 3300042619 | Bacteria | 1221 |
| 260 | Ga0466729_194782 | 3300042621 | Bacteria | 2981 |
| 261 | Ga0233288_1008683 | 3300022232 | Bacteria | 1798 |
| 262 | Ga0264413_110267 | 3300024493 | Bacteria | 6069 |
| 263 | Ga0466690_108374 | 3300042590 | Bacteria | 18290 |
| 264 | Ga0466690_205124 | 3300042590 | Bacteria | 1931 |
| 265 | Ga0466690_253865 | 3300042590 | Bacteria | 7588 |
| 266 | Ga0466694_131062 | 3300042594 | Bacteria | 33615 |
| 267 | Ga0466694_141741 | 3300042594 | Bacteria | 36896 |
| 268 | Ga0466696_081774 | 3300042596 | Bacteria | 9836 |
| 269 | Ga0466696_331190 | 3300042596 | Bacteria | 65152 |
| 270 | Ga0466699_173015 | 3300042597 | Bacteria | 15650 |
| 271 | AustNasuHG_c1000021 | 3300000089 | Bacteria | 36984 |
| 272 | AustNasuHG_c1000040 | 3300000089 | Bacteria | 32335 |
| 273 | JGI24698J34947_10008779 | 3300002449 | Bacteria | 5543 |
| 274 | JGI24698J34947_10038374 | 3300002449 | Unclassified | 2484 |
| 275 | JGI24695J34938_10044468 | 3300002450 | Bacteria | 1975 |
| 276 | JGI24695J34938_10048624 | 3300002450 | Bacteria | 1867 |
| 277 | Ga0072941_1014210 | 3300005201 | Bacteria | 33023 |
| 278 | Ga0466729_268905 | 3300042621 | Bacteria | 2649 |
| 279 | Ga0466735_121968 | 3300042624 | Bacteria | 2603 |
| 280 | Ga0466708_155834 | 3300042652 | Bacteria | 3925 |
| 281 | Ga0466708_188746 | 3300042652 | Bacteria | 4461 |
| 282 | Ga0466708_217537 | 3300042652 | Bacteria | 33917 |
| 283 | Ga0466708_283256 | 3300042652 | Bacteria | 2017 |
| 284 | Ga0466727_167362 | 3300042655 | Unclassified | 3448 |
| 285 | Ga0466707_160565 | 3300042601 | Bacteria | 2148 |
| 286 | Ga0466719_182646 | 3300042606 | Unclassified | 1975 |
| 287 | Ga0466719_192978 | 3300042606 | Bacteria | 28565 |
| 288 | Ga0466719_378896 | 3300042606 | Bacteria | 3654 |
| 289 | Ga0466722_061294 | 3300042609 | Bacteria | 12769 |
| 290 | Ga0466705_002035 | 3300042612 | Bacteria | 28663 |
| 291 | Ga0466705_131368 | 3300042612 | Bacteria | 5177 |
| 292 | Ga0466705_169714 | 3300042612 | Bacteria | 6814 |
| 293 | Ga0466705_231567 | 3300042612 | Bacteria | 11191 |
| 294 | Ga0466711_220133 | 3300042615 | Bacteria | 5019 |
| 295 | Ga0466718_003421 | 3300042617 | Bacteria | 1741 |
| 296 | Ga0466718_081020 | 3300042617 | Bacteria | 3033 |
| 297 | Ga0466718_092740 | 3300042617 | Bacteria | 26065 |
| 298 | Ga0466718_099534 | 3300042617 | Bacteria | 3767 |
| 299 | Ga0466718_103445 | 3300042617 | Bacteria | 2004 |
| 300 | Ga0466723_093730 | 3300042618 | Bacteria | 27934 |
| 301 | Ga0466723_150950 | 3300042618 | Bacteria | 119524 |
| 302 | Ga0466723_195456 | 3300042618 | Bacteria | 36467 |
| 303 | Ga0466723_253883 | 3300042618 | Bacteria | 3025 |
| 304 | Ga0466726_411176 | 3300042619 | Bacteria | 1414 |
| 305 | Ga0466728_427101 | 3300042620 | Bacteria | 1869 |
| 306 | Ga0123356_10018312 | 3300010049 | Bacteria | 6651 |
| 307 | Ga0123353_10219640 | 3300010167 | Bacteria | 2973 |
| 308 | Ga0123353_10810650 | 3300010167 | Bacteria | 1291 |
| 309 | Ga0233288_1023088 | 3300022232 | Bacteria | 1705 |
| 310 | Ga0264413_101300 | 3300024493 | Bacteria | 5601 |
| 311 | Ga0264413_108243 | 3300024493 | Bacteria | 5830 |
| 312 | Ga0264413_110268 | 3300024493 | Bacteria | 8440 |
| 313 | Ga0466690_171962 | 3300042590 | Bacteria | 6194 |
| 314 | Ga0466692_095136 | 3300042591 | Bacteria | 2815 |
| 315 | Ga0466692_116070 | 3300042591 | Bacteria | 64124 |
| 316 | Ga0466694_058703 | 3300042594 | Bacteria | 2239 |
| 317 | Ga0466694_147121 | 3300042594 | Bacteria | 6988 |
| 318 | Ga0466694_271421 | 3300042594 | Bacteria | 2472 |
| 319 | Ga0466696_070245 | 3300042596 | Bacteria | 2290 |
| 320 | Ga0466696_446926 | 3300042596 | Bacteria | 40059 |
| 321 | Ga0466699_363050 | 3300042597 | Bacteria | 3984 |
| 322 | AustNasuHG_c1001574 | 3300000089 | Bacteria | 8226 |
| 323 | JGI24698J34947_10026024 | 3300002449 | Unclassified | 3111 |
| 324 | JGI24702J35022_10013045 | 3300002462 | Bacteria | 4610 |
| 325 | Ga0068302_10006377 | 3300005071 | Bacteria | 2545 |
| 326 | Ga0072941_1026670 | 3300005201 | Unclassified | 3672 |
| 327 | Ga0072941_1086165 | 3300005201 | Bacteria | 5972 |
| 328 | Ga0466731_160633 | 3300042622 | Bacteria | 1098 |
| 329 | Ga0466731_197424 | 3300042622 | Bacteria | 2296 |
| 330 | Ga0466735_052384 | 3300042624 | Bacteria | 1076 |
| 331 | Ga0466735_124865 | 3300042624 | Bacteria | 1205 |
| 332 | Ga0466704_350269 | 3300042643 | Bacteria | 2572 |
| 333 | Ga0466704_351243 | 3300042643 | Bacteria | 9773 |
| 334 | Ga0466709_115105 | 3300042648 | Bacteria | 20186 |
| 335 | Ga0466708_018878 | 3300042652 | Bacteria | 4713 |
| 336 | Ga0466708_098277 | 3300042652 | Bacteria | 37898 |
| 337 | Ga0466720_028424 | 3300042607 | Bacteria | 1619 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04620 | FlaA | Flagellar filament outer layer protein Flaa | 54 | 254 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.