Protein Family IF09906
Metagenome
Isolate
154
Members
54
Samples
133
Scaffolds
379.4
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_138315|Ga0466708_138315_236_1549
- Length
- 437 aa
- Sequence
- VLRAVLNRHAGVLFGIPGGGWSFVFSGDAAVTYIHVYLQQNLKKMNSMKQIATSCPSLGGMLCACLVWLASCTDSKFTVEGVVSGADGQVMYFESVGISSVQILDSVRLTADGKFAFRRSRPPYPEFYRFRLNSQWINFSIDSTETLTFAADGGTFATSYTVEGSENAKAIKEITLAQLDANQAIGRLRKERDTHLIPDTAFQSRLSEAAEAYKEVARRYIYSAPMSAVAYFALFQQIDGLLFFDLYNKEDSKAYGAVATSFDHYYPGSMRARHLHNLALQSIKVIRRQRAASEAGSAPVNITEISYLDIVLPNLKGEKVSLSSVAENKAVLINFTAYRSEWSPSLNMDLGDIYTKYSARGLAIYQVSLDADTHYWKNVSSNLPWVCVRDPESVYSQIAALYNVKQLPALFLLDRKGNLVKRIDDLKTLDEDVRKVL
Sample Types
Isolate
13.6%
Metagenome
86.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
38.9%
Kalotermitidae
25.9%
Termitidae
13.0%
Termopsidae
7.4%
Rhinotermitidae
5.6%
Unclassified
5.6%
Passalidae
3.7%
Taxonomy
Archaea
1
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 2 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 3 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 4 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 16 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 17 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 18 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 21 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 22 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 23 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 30 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 31 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 32 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 46 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 47 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 48 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_119795 | 3300042590 | Bacteria | 7830 |
| 2 | Ga0466696_478872 | 3300042596 | Bacteria | 4509 |
| 3 | Ga0466711_011751 | 3300042615 | Bacteria | 11761 |
| 4 | Ga0466711_242355 | 3300042615 | Bacteria | 12439 |
| 5 | Ga0466715_379600 | 3300042616 | Bacteria | 22114 |
| 6 | Ga0466723_067180 | 3300042618 | Bacteria | 17674 |
| 7 | Ga0466723_295693 | 3300042618 | Bacteria | 5360 |
| 8 | Ga0466726_247201 | 3300042619 | Unclassified | 1386 |
| 9 | Ga0466703_305853 | 3300042636 | Bacteria | 13397 |
| 10 | Ga0466704_086682 | 3300042643 | Bacteria | 2810 |
| 11 | Ga0466704_362007 | 3300042643 | Bacteria | 16295 |
| 12 | Ga0466704_407394 | 3300042643 | Bacteria | 14777 |
| 13 | Ga0466709_376503 | 3300042648 | Bacteria | 12791 |
| 14 | Ga0466708_138315 | 3300042652 | Bacteria | 9699 |
| 15 | 2227236350 | 2225789004 | Bacteria | 7289 |
| 16 | IMNBL1DRAFT_c0020421 | 3300000062 | Bacteria | 2683 |
| 17 | Ga0068302_10143416 | 3300005071 | Archaea | 5301 |
| 18 | Ga0068305_10026750 | 3300005083 | Bacteria | 10368 |
| 19 | Ga0068305_10107345 | 3300005083 | Bacteria | 4367 |
| 20 | Ga0466713_035995 | 3300042602 | Unclassified | 2456 |
| 21 | Ga0466713_077436 | 3300042602 | Bacteria | 22165 |
| 22 | Ga0466716_481572 | 3300042605 | Bacteria | 9267 |
| 23 | Ga0466719_083574 | 3300042606 | Bacteria | 8476 |
| 24 | Ga0466722_009058 | 3300042609 | Bacteria | 56021 |
| 25 | Ga0466705_033023 | 3300042612 | Bacteria | 10482 |
| 26 | Ga0466705_141557 | 3300042612 | Unclassified | 1642 |
| 27 | Ga0123353_10123586 | 3300010167 | Bacteria | 4160 |
| 28 | Ga0466691_037330 | 3300042593 | Bacteria | 15244 |
| 29 | Ga0466711_057542 | 3300042615 | Bacteria | 70908 |
| 30 | Ga0466715_079052 | 3300042616 | Bacteria | 26117 |
| 31 | Ga0466715_464975 | 3300042616 | Bacteria | 101862 |
| 32 | Ga0466723_035858 | 3300042618 | Bacteria | 52046 |
| 33 | Ga0466735_113576 | 3300042624 | Bacteria | 5539 |
| 34 | Ga0466703_001425 | 3300042636 | Bacteria | 12119 |
| 35 | Ga0466703_042698 | 3300042636 | Bacteria | 15132 |
| 36 | Ga0466703_048088 | 3300042636 | Bacteria | 40180 |
| 37 | Ga0466703_065818 | 3300042636 | Bacteria | 14556 |
| 38 | Ga0466704_070153 | 3300042643 | Bacteria | 6572 |
| 39 | 2227463557 | 2225789004 | Bacteria | 5308 |
| 40 | IMNBL1DRAFT_c0002120 | 3300000062 | Bacteria | 14126 |
| 41 | IMNBL1DRAFT_c0013829 | 3300000062 | Bacteria | 3595 |
| 42 | JGI24702J35022_10002836 | 3300002462 | Bacteria | 10499 |
| 43 | Ga0466716_209854 | 3300042605 | Bacteria | 2150 |
| 44 | Ga0466705_011422 | 3300042612 | Bacteria | 4514 |
| 45 | Ga0466696_170321 | 3300042596 | Bacteria | 10269 |
| 46 | Ga0466696_288691 | 3300042596 | Bacteria | 66943 |
| 47 | Ga0466711_204836 | 3300042615 | Bacteria | 21772 |
| 48 | Ga0466715_137250 | 3300042616 | Bacteria | 2234 |
| 49 | Ga0466715_227174 | 3300042616 | Bacteria | 15989 |
| 50 | Ga0466715_368612 | 3300042616 | Bacteria | 6621 |
| 51 | Ga0466703_289947 | 3300042636 | Bacteria | 14348 |
| 52 | Ga0466704_080956 | 3300042643 | Bacteria | 7262 |
| 53 | Ga0466709_006965 | 3300042648 | Bacteria | 10318 |
| 54 | Ga0466727_225961 | 3300042655 | Bacteria | 24553 |
| 55 | IMNBL1DRAFT_c0008174 | 3300000062 | Bacteria | 5369 |
| 56 | JGI24702J35022_10007003 | 3300002462 | Bacteria | 6477 |
| 57 | JGI24702J35022_10011694 | 3300002462 | Bacteria | 4892 |
| 58 | Ga0068305_10417480 | 3300005083 | Bacteria | 5660 |
| 59 | Ga0466713_110049 | 3300042602 | Bacteria | 19208 |
| 60 | Ga0466705_053356 | 3300042612 | Bacteria | 6242 |
| 61 | Ga0466705_376176 | 3300042612 | Bacteria | 16984 |
| 62 | Ga0466691_038866 | 3300042593 | Bacteria | 19756 |
| 63 | Ga0466715_402619 | 3300042616 | Bacteria | 10360 |
| 64 | Ga0466728_411536 | 3300042620 | Bacteria | 1852 |
| 65 | Ga0466729_184776 | 3300042621 | Bacteria | 8446 |
| 66 | Ga0466704_083976 | 3300042643 | Bacteria | 7082 |
| 67 | Ga0466704_316925 | 3300042643 | Bacteria | 8161 |
| 68 | 2227372472 | 2225789004 | Bacteria | 5996 |
| 69 | IMNBL1DRAFT_c0002798 | 3300000062 | Unclassified | 11802 |
| 70 | Ga0068305_10091142 | 3300005083 | Bacteria | 5256 |
| 71 | Ga0466719_292287 | 3300042606 | Bacteria | 2552 |
| 72 | Ga0466719_431354 | 3300042606 | Bacteria | 5137 |
| 73 | Ga0466722_012357 | 3300042609 | Bacteria | 11530 |
| 74 | Ga0466722_062477 | 3300042609 | Bacteria | 11403 |
| 75 | Ga0466722_231082 | 3300042609 | Bacteria | 5835 |
| 76 | Ga0466705_170506 | 3300042612 | Bacteria | 11627 |
| 77 | Ga0466690_293895 | 3300042590 | Bacteria | 67504 |
| 78 | Ga0466705_438498 | 3300042612 | Bacteria | 6573 |
| 79 | Ga0466711_443540 | 3300042615 | Bacteria | 17011 |
| 80 | Ga0466715_273908 | 3300042616 | Bacteria | 8602 |
| 81 | Ga0466726_065128 | 3300042619 | Bacteria | 4985 |
| 82 | Ga0466703_257396 | 3300042636 | Bacteria | 15106 |
| 83 | Ga0466704_275304 | 3300042643 | Bacteria | 2376 |
| 84 | Ga0466709_358740 | 3300042648 | Bacteria | 10195 |
| 85 | Ga0466708_120576 | 3300042652 | Bacteria | 34134 |
| 86 | Ga0466727_047526 | 3300042655 | Bacteria | 13694 |
| 87 | Ga0068302_10131825 | 3300005071 | Bacteria | 1317 |
| 88 | Ga0068305_10155444 | 3300005083 | Bacteria | 1414 |
| 89 | Ga0466707_086135 | 3300042601 | Bacteria | 11633 |
| 90 | Ga0466716_153013 | 3300042605 | Bacteria | 5413 |
| 91 | Ga0466719_353865 | 3300042606 | Bacteria | 4055 |
| 92 | Ga0466733_122024 | 3300042659 | Bacteria | 33739 |
| 93 | Ga0123357_10060264 | 3300009784 | Bacteria | 5091 |
| 94 | Ga0123354_10214892 | 3300010882 | Bacteria | 2064 |
| 95 | Ga0466692_126527 | 3300042591 | Bacteria | 33875 |
| 96 | Ga0466711_433146 | 3300042615 | Bacteria | 1669 |
| 97 | Ga0466715_276387 | 3300042616 | Bacteria | 1775 |
| 98 | Ga0466715_600427 | 3300042616 | Bacteria | 2440 |
| 99 | Ga0466704_053279 | 3300042643 | Bacteria | 19722 |
| 100 | Ga0466704_070354 | 3300042643 | Bacteria | 3918 |
| 101 | Ga0466727_327206 | 3300042655 | Bacteria | 9929 |
| 102 | JGI24702J35022_10000119 | 3300002462 | Bacteria | 37881 |
| 103 | JGI24702J35022_10069895 | 3300002462 | Bacteria | 1889 |
| 104 | Ga0068302_10204565 | 3300005071 | Bacteria | 4487 |
| 105 | Ga0466719_299936 | 3300042606 | Bacteria | 4408 |
| 106 | Ga0466705_301453 | 3300042612 | Unclassified | 1712 |
| 107 | Ga0466691_200679 | 3300042593 | Bacteria | 4888 |
| 108 | Ga0466696_275316 | 3300042596 | Bacteria | 11489 |
| 109 | Ga0466728_442771 | 3300042620 | Unclassified | 14886 |
| 110 | Ga0466704_493757 | 3300042643 | Bacteria | 5631 |
| 111 | Ga0466725_072352 | 3300042654 | Bacteria | 12854 |
| 112 | Ga0466725_103641 | 3300042654 | Bacteria | 2249 |
| 113 | Ga0466727_090785 | 3300042655 | Bacteria | 2330 |
| 114 | Ga0466713_024465 | 3300042602 | Bacteria | 3815 |
| 115 | Ga0466713_061789 | 3300042602 | Bacteria | 88378 |
| 116 | Ga0466713_097614 | 3300042602 | Bacteria | 86999 |
| 117 | Ga0466722_210054 | 3300042609 | Bacteria | 3969 |
| 118 | Ga0466705_295334 | 3300042612 | Bacteria | 16542 |
| 119 | Ga0466733_170460 | 3300042659 | Bacteria | 186955 |
| 120 | Ga0466690_034613 | 3300042590 | Bacteria | 14840 |
| 121 | Ga0466692_008872 | 3300042591 | Bacteria | 29437 |
| 122 | Ga0466694_065712 | 3300042594 | Bacteria | 1971 |
| 123 | Ga0466696_441208 | 3300042596 | Bacteria | 3655 |
| 124 | Ga0466726_049116 | 3300042619 | Bacteria | 5096 |
| 125 | Ga0466726_382645 | 3300042619 | Bacteria | 9872 |
| 126 | Ga0466728_093101 | 3300042620 | Bacteria | 13078 |
| 127 | Ga0466709_188845 | 3300042648 | Bacteria | 15042 |
| 128 | JGI24702J35022_10001583 | 3300002462 | Bacteria | 14117 |
| 129 | Ga0466707_160588 | 3300042601 | Bacteria | 3045 |
| 130 | Ga0466713_018768 | 3300042602 | Bacteria | 4128 |
| 131 | Ga0466716_076910 | 3300042605 | Bacteria | 11677 |
| 132 | Ga0466719_172082 | 3300042606 | Bacteria | 4925 |
| 133 | Ga0466719_520961 | 3300042606 | Bacteria | 6106 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.