Protein Family IF09905

Metagenome Isolate
313 Members
207 Samples
162 Scaffolds
543.81 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_136838|Ga0466708_136838_25315_27276
Length
653 aa
Sequence
MVDVKISSSDIRKALDGFIKNFNTDAPQMNEVGHVSAAGDGIVHVVGLPSARASELLRFEDGTLGLAMNLDEREIGVVVLGDFECIDEGQEVRRTGEVLSVPVGDGYLGRVVDAMGDPVDGLGKIKTEGRRVLEAQAPGVMDRKSVFEPLHTGIKAVDTMTPIGRGQRQLIIGDRQTGKTAIAIDTIINQKADWETGDPTKQVRCIYVAIGQKGTAISSVKAVLEEADAMKHTTIISAPASDSAGFKYLAAYTGSAIGQHWMYNGKHVLIVFDDLSKQSDAYRSVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGGGSMTGLPIVETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGTAQTKAMKKVTGTLKIELAKYRSLESFSMFASDLDAASKAQLARGERLTELLKQQQYDPFSFDKQVVMVWAGLNGKLDDVPVADIHRFESEFLEYLESMTDILTRICATEDLNEPIYAALEEAVENFKNTFVSGDKKFLTEIRIEDEEPPPVVQVKISPKPAENKHLTKKPASEIGPGVKTAVQSAETVAKTAELKTAVGSSSIKSNNTENKRNAVRTAXXXXFRRVTKTAPKSSRSAVGLKKTDATADASVQKRRGRPLGTKSRPRNTNTVS

πŸ“Š Sample Types

Isolate 48.2%
Metagenome 51.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 30.1%
Termitidae 11.7%
Apidae 9.2%
Formicidae 8.2%
Kalotermitidae 6.1%
Anthocoridae 5.1%
Scarabaeidae 4.1%
Cambaridae 4.1%
Tenebrionidae 3.6%
Culicidae 3.1%
Elmidae 2.0%
Armadillidiidae 2.0%
Hydrophilidae 1.5%
Dytiscidae 1.5%
Rhinotermitidae 1.0%
Curculionidae 1.0%
Termopsidae 1.0%
Cimicidae 0.5%
Pyralidae 0.5%
Thomisidae 0.5%
Hodotermitidae 0.5%
Cerambycidae 0.5%
Reduviidae 0.5%
Ixodidae 0.5%
Chironomidae 0.5%
Siricidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 301
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
2 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
3 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
4 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
5 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
6 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
7 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
8 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
9 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
10 2505679068 Isoptericola variabilis 225 Isolate Unclassified
11 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
12 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
13 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
14 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
15 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
16 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
17 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
21 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
22 8062637095 Yimella sp. cx-51 Isolate Cambaridae
23 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
24 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
29 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
30 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
31 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
32 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
33 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
34 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
35 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
36 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
37 2912749649 Streptomyces sp. GS7 Isolate Termitidae
38 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
39 2802429577 Bifidobacterium indicum DSM 20214 Isolate Unclassified
40 3006461590 Streptomyces sp. RB5 Isolate Termitidae
41 3006667155 Streptomyces sp. SID9727 Isolate
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
44 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
45 8062747827 Yimella sp. cx-51 Isolate Cambaridae
46 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
47 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
48 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
49 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
50 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
51 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
52 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
53 2862784999 Streptomyces sp. M41 Isolate Unclassified
54 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
55 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
56 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
57 2931425734 Nocardioides sp. J2M5 Isolate
58 2931430189 Tessaracoccus palaemonis J1M15 Isolate
59 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
60 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
61 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
62 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
63 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
64 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
65 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
66 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
67 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
68 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
69 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
70 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
71 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
72 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
73 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
74 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
75 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
76 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
77 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
78 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
79 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
80 2908241010 Streptomyces sp. HF10 Isolate Termitidae
81 2912817845 Streptomyces griseus SID164 Isolate
82 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
83 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
84 3006468911 Streptomyces sp. RB17 Isolate Termitidae
85 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
86 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
87 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
88 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
89 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
90 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
91 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
92 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
93 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
94 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
95 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
96 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
97 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
98 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
99 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
100 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
101 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
102 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
103 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
104 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
105 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
106 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
107 2504756063 Isoptericola variabilis J5 Isolate Unclassified
108 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
109 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
110 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
111 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
112 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
113 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
114 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
115 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
116 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
117 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
118 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
119 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
120 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
121 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
122 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
123 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
124 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
125 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
126 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
127 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
128 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
129 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
130 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
131 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
132 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
133 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
134 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
135 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
136 2547132081 Streptomyces sp. S4 Isolate Formicidae
137 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
138 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
139 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
140 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
141 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
142 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
143 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
144 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
145 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
146 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
147 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
148 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
149 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
150 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
151 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
152 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
153 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
154 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
155 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
156 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
157 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
158 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
159 2896955351 Streptomyces sp. GF20 Isolate Termitidae
160 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
161 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
162 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
163 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
164 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
165 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
166 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
167 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
168 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
169 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
170 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
171 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
172 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
173 649989992 Pseudonocardia sp. P1 Isolate Formicidae
174 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
175 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
176 8073544309 Actinomadura sp. RB99 Isolate Termitidae
177 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
178 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
179 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
180 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
181 2820840446 Unclassified Actinobacteria Lab288P4bin17 Isolate Unclassified
182 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
183 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
184 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
185 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
186 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
187 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
188 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
189 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
190 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
191 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
192 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
193 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
194 2568526170 Bifidobacterium sp. A11 Isolate Apidae
195 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
196 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
197 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
198 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
199 3002678670 Agromyces sp. G127AT Isolate Unclassified
200 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
201 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
202 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
203 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
204 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
205 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
206 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
207 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_236625 3300042612 Bacteria 7099
2 Ga0562379_0402 3300056790 Unclassified 96507
3 Ga0562378_0056 3300056814 Bacteria 330468
4 Ga0562376_0591 3300056857 Bacteria 62411
5 Ga0562376_0843 3300056857 Bacteria 48926
6 Ga0562374_1701 3300057007 Unclassified 24302
7 Ga0123357_10008027 3300009784 Bacteria 13132
8 Ga0123356_10006241 3300010049 Bacteria 12040
9 Ga0160464_101324 3300012805 Unclassified 9197
10 Ga0466710_114090 3300042613 Bacteria 6718
11 Ga0466718_050676 3300042617 Bacteria 3835
12 Ga0466723_097381 3300042618 Bacteria 2013
13 Ga0466728_448394 3300042620 Bacteria 23247
14 Ga0466693_218291 3300042592 Bacteria 114325
15 Ga0123357_10003224 3300009784 Bacteria 18583
16 Ga0466730_047792 3300042625 Bacteria 11676
17 Ga0466703_154941 3300042636 Bacteria 85625
18 Ga0466703_282486 3300042636 Bacteria 29799
19 Ga0466704_224392 3300042643 Bacteria 98795
20 Ga0466704_460534 3300042643 Bacteria 24087
21 Ga0466727_014598 3300042655 Bacteria 2727
22 Ga0466727_231247 3300042655 Bacteria 8915
23 Ga0466705_308494 3300042612 Bacteria 9715
24 Ga0562379_0149 3300056790 Bacteria 210994
25 Ga0562375_1433 3300056856 Unclassified 32359
26 Ga0562376_0050 3300056857 Bacteria 302526
27 Ga0562376_0559 3300056857 Bacteria 65453
28 Ga0123356_10000018 3300010049 Bacteria 184445
29 Ga0123356_10000060 3300010049 Bacteria 114492
30 Ga0123353_10006264 3300010167 Bacteria 15821
31 Ga0123353_10065471 3300010167 Bacteria 5834
32 Ga0466705_505129 3300042612 Bacteria 3563
33 Ga0466723_036599 3300042618 Bacteria 10445
34 Ga0466726_278994 3300042619 Bacteria 2406
35 Ga0466728_480864 3300042620 Bacteria 18384
36 Ga0160441_100149 3300012825 Bacteria 75675
37 Ga0160435_1000160 3300012857 Bacteria 35700
38 Ga0466693_028471 3300042592 Bacteria 150342
39 Ga0466691_204771 3300042593 Bacteria 10627
40 Ga0466707_029198 3300042601 Bacteria 75924
41 Ga0466707_098458 3300042601 Bacteria 2719
42 Ga0466707_414636 3300042601 Bacteria 5194
43 Ga0466713_041817 3300042602 Bacteria 31137
44 Ga0466713_047200 3300042602 Bacteria 14547
45 Ga0466704_425431 3300042643 Bacteria 4450
46 Ga0466708_136838 3300042652 Bacteria 36246
47 Ga0466708_447943 3300042652 Bacteria 5044
48 Ga0466733_052807 3300042659 Bacteria 19875
49 Ga0466733_186866 3300042659 Bacteria 153934
50 Ga0562377_0107 3300056842 Bacteria 267817
51 Ga0562375_0039 3300056856 Bacteria 581627
52 Ga0562376_0344 3300056857 Bacteria 90240
53 Ga0123356_10000270 3300010049 Bacteria 59436
54 Ga0466715_081297 3300042616 Bacteria 107795
55 Ga0160460_101596 3300012845 Unclassified 7105
56 Ga0466706_171699 3300042599 Bacteria 13685
57 Ga0466719_054841 3300042606 Bacteria 25243
58 Ga0466719_299139 3300042606 Bacteria 7928
59 Ga0123357_10000457 3300009784 Bacteria 39518
60 Ga0562378_0214 3300056814 Unclassified 138321
61 Ga0562377_0009 3300056842 Bacteria 1580355
62 Ga0562377_0990 3300056842 Bacteria 35443
63 Ga0562375_0028 3300056856 Bacteria 708255
64 Ga0562375_1483 3300056856 Bacteria 31413
65 Ga0562376_1556 3300056857 Unclassified 31569
66 Ga0562376_5096 3300056857 Unclassified 9341
67 Ga0123357_10142004 3300009784 Bacteria 2947
68 Ga0466715_215397 3300042616 Bacteria 6759
69 Ga0466729_163048 3300042621 Bacteria 3705
70 Ga0160432_101128 3300012818 Bacteria 9923
71 Ga0160469_100956 3300012824 Bacteria 9454
72 Ga0160443_100331 3300012848 Bacteria 43686
73 Ga0160435_1005814 3300012857 Bacteria 2767
74 Ga0466706_075155 3300042599 Bacteria 8738
75 Ga0466713_030111 3300042602 Bacteria 26577
76 Ga0466716_007623 3300042605 Bacteria 21316
77 JGI24705J35276_12235802 3300002504 Bacteria 6996
78 Ga0123357_10000060 3300009784 Bacteria 86303
79 Ga0466730_060072 3300042625 Bacteria 33699
80 Ga0466703_103283 3300042636 Bacteria 41411
81 Ga0466724_27823 3300042649 Bacteria 4011
82 Ga0562375_0003 3300056856 Bacteria 3519784
83 Ga0562375_0295 3300056856 Bacteria 125606
84 Ga0562376_0014 3300056857 Bacteria 651340
85 Ga0562376_0017 3300056857 Bacteria 512858
86 Ga0562376_1066 3300056857 Bacteria 41107
87 Ga0562376_4695 3300056857 Unclassified 10682
88 Ga0562374_0040 3300057007 Bacteria 642660
89 Ga0123356_10000589 3300010049 Bacteria 40398
90 Ga0123356_10017904 3300010049 Bacteria 6731
91 Ga0123354_10001229 3300010882 Bacteria 30337
92 Ga0160442_101000 3300012806 Bacteria 3894
93 Ga0160452_100091 3300012834 Bacteria 119942
94 Ga0466696_301265 3300042596 Bacteria 5191
95 Ga0466707_297878 3300042601 Bacteria 29546
96 Ga0466713_101616 3300042602 Bacteria 503322
97 JGI24699J35502_11128394 3300002509 Bacteria 4401
98 JGI24699J35502_11134044 3300002509 Bacteria 26547
99 Ga0072941_1022844 3300005201 Bacteria 33498
100 Ga0123357_10000793 3300009784 Bacteria 31979
101 Ga0123357_10002981 3300009784 Bacteria 19160
102 Ga0466703_230474 3300042636 Bacteria 13370
103 Ga0466704_612816 3300042643 Bacteria 4522
104 Ga0466724_66581 3300042649 Bacteria 665985
105 Ga0466727_168193 3300042655 Bacteria 3588
106 Ga0562378_0226 3300056814 Bacteria 131582
107 Ga0123354_10012498 3300010882 Bacteria 13161
108 Ga0466715_401782 3300042616 Bacteria 4075
109 Ga0466723_177586 3300042618 Bacteria 31384
110 Ga0466728_197975 3300042620 Bacteria 65109
111 Ga0466729_031845 3300042621 Bacteria 11771
112 Ga0160432_100027 3300012818 Bacteria 254467
113 Ga0160446_100049 3300012835 Bacteria 126519
114 Ga0160430_102116 3300012852 Unclassified 6548
115 Ga0160457_1001970 3300012858 Bacteria 4859
116 Ga0160436_1000043 3300012861 Bacteria 69783
117 Ga0466696_118881 3300042596 Bacteria 3307
118 Ga0466707_031682 3300042601 Bacteria 15474
119 Ga0466713_054471 3300042602 Bacteria 15127
120 Ga0466713_089541 3300042602 Bacteria 7573
121 Ga0466719_032737 3300042606 Bacteria 46378
122 Ga0466703_081033 3300042636 Bacteria 68460
123 Ga0466703_092170 3300042636 Bacteria 13029
124 Ga0466705_101507 3300042612 Bacteria 2000
125 Ga0562379_0267 3300056790 Bacteria 136214
126 Ga0562379_0706 3300056790 Unclassified 56284
127 Ga0562377_0171 3300056842 Bacteria 177929
128 Ga0562375_0370 3300056856 Bacteria 100886
129 Ga0562376_1702 3300056857 Bacteria 29625
130 Ga0562374_0005 3300057007 Bacteria 2987673
131 Ga0466711_207306 3300042615 Bacteria 34540
132 Ga0466711_349245 3300042615 Bacteria 6212
133 Ga0466718_059312 3300042617 Bacteria 8485
134 Ga0160472_100018 3300012839 Bacteria 365803
135 Ga0160445_100043 3300012847 Bacteria 156279
136 Ga0415639_016003 3300038395 Bacteria 3799
137 Ga0466696_160085 3300042596 Bacteria 32772
138 Ga0466700_466513 3300042600 Bacteria 7011
139 Ga0466707_080865 3300042601 Bacteria 320076
140 Ga0466716_241108 3300042605 Bacteria 14653
141 Ga0466716_503333 3300042605 Bacteria 3056
142 Ga0466719_461092 3300042606 Bacteria 5160
143 Ga0466722_115391 3300042609 Bacteria 8699
144 Ga0466722_157638 3300042609 Bacteria 26308
145 JGI24699J35502_11132310 3300002509 Unclassified 6672
146 Ga0072940_1005053 3300005200 Bacteria 9015
147 Ga0466730_043082 3300042625 Bacteria 8009
148 Ga0466703_379518 3300042636 Bacteria 2043
149 Ga0466704_140814 3300042643 Bacteria 14631
150 Ga0466704_470155 3300042643 Bacteria 237345
151 Ga0466725_267359 3300042654 Bacteria 4496
152 Ga0466733_075551 3300042659 Bacteria 23886
153 Ga0562378_0012 3300056814 Bacteria 1041899
154 Ga0562376_0628 3300056857 Bacteria 59834
155 Ga0466723_080148 3300042618 Bacteria 2139
156 Ga0466706_261061 3300042599 Bacteria 6514
157 Ga0466713_142821 3300042602 Bacteria 20531
158 Ga0466730_061384 3300042625 Bacteria 7559
159 Ga0466703_274121 3300042636 Bacteria 5746
160 Ga0466724_59942 3300042649 Bacteria 27518
161 Ga0466724_64100 3300042649 Bacteria 707103
162 Ga0466725_318825 3300042654 Bacteria 4838

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain 153 376 0.99
PF00306 ATP-synt_ab_C ATP synthase alpha/beta chain, C terminal domain 383 507 0.99
PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain 30 96 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00006 GO:0005524 ATP binding MF
PF00306 GO:0015986 proton motive force-driven ATP synthesis BP

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.