Protein Family IF09905
Metagenome
Isolate
313
Members
207
Samples
162
Scaffolds
543.81
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_136838|Ga0466708_136838_25315_27276
- Length
- 653 aa
- Sequence
- MVDVKISSSDIRKALDGFIKNFNTDAPQMNEVGHVSAAGDGIVHVVGLPSARASELLRFEDGTLGLAMNLDEREIGVVVLGDFECIDEGQEVRRTGEVLSVPVGDGYLGRVVDAMGDPVDGLGKIKTEGRRVLEAQAPGVMDRKSVFEPLHTGIKAVDTMTPIGRGQRQLIIGDRQTGKTAIAIDTIINQKADWETGDPTKQVRCIYVAIGQKGTAISSVKAVLEEADAMKHTTIISAPASDSAGFKYLAAYTGSAIGQHWMYNGKHVLIVFDDLSKQSDAYRSVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGGGSMTGLPIVETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGTAQTKAMKKVTGTLKIELAKYRSLESFSMFASDLDAASKAQLARGERLTELLKQQQYDPFSFDKQVVMVWAGLNGKLDDVPVADIHRFESEFLEYLESMTDILTRICATEDLNEPIYAALEEAVENFKNTFVSGDKKFLTEIRIEDEEPPPVVQVKISPKPAENKHLTKKPASEIGPGVKTAVQSAETVAKTAELKTAVGSSSIKSNNTENKRNAVRTAXXXXFRRVTKTAPKSSRSAVGLKKTDATADASVQKRRGRPLGTKSRPRNTNTVS
Sample Types
Isolate
48.2%
Metagenome
51.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.1%
Termitidae
11.7%
Apidae
9.2%
Formicidae
8.2%
Kalotermitidae
6.1%
Anthocoridae
5.1%
Scarabaeidae
4.1%
Cambaridae
4.1%
Tenebrionidae
3.6%
Culicidae
3.1%
Elmidae
2.0%
Armadillidiidae
2.0%
Hydrophilidae
1.5%
Dytiscidae
1.5%
Rhinotermitidae
1.0%
Curculionidae
1.0%
Termopsidae
1.0%
Cimicidae
0.5%
Pyralidae
0.5%
Thomisidae
0.5%
Hodotermitidae
0.5%
Cerambycidae
0.5%
Reduviidae
0.5%
Ixodidae
0.5%
Chironomidae
0.5%
Siricidae
0.5%
Taxonomy
Archaea
0
Bacteria
301
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 2 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 3 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 4 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 5 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 6 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 7 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 8 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 9 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 10 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 11 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 12 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 13 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 14 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 15 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 16 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 17 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 21 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 22 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 23 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 24 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 29 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 30 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 31 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 32 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 33 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 34 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 35 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 36 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 37 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 38 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 39 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 40 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 41 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 44 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 45 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 46 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 47 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 48 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 49 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 50 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 51 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 52 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 53 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 54 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 55 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 56 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 57 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 58 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 59 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 60 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 61 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 62 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 63 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 64 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 65 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 66 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 67 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 68 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 69 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 70 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 71 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 72 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 73 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 74 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 75 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 76 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 77 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 78 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 79 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 80 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 81 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 82 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 83 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 84 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 85 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 86 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 87 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 88 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 89 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 90 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 91 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 92 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 93 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 94 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 95 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 96 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 97 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 98 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 99 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 100 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 101 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 102 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 103 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 104 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 105 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 106 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 107 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 108 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 109 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 110 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 111 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 112 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 113 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 114 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 115 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 116 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 117 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 118 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 119 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 120 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 121 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 122 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 123 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 124 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 125 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 126 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 127 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 128 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 129 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 130 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 131 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 132 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 133 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 134 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 135 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 136 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 137 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 138 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 139 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 140 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 141 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 142 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 143 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 144 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 145 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 146 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 147 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 148 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 149 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 150 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 151 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 152 | 2821316722 | Unclassified Actinobacteria Lab288P1bin78 | Isolate | Unclassified |
| 153 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 154 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 155 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 156 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 157 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 158 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 159 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 160 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 161 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 162 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 163 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 164 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 165 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 166 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 167 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 168 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 169 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 170 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 171 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 172 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 173 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 174 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 175 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 176 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 177 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 178 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 179 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 180 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 181 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 182 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 183 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 184 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 185 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 186 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 187 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 188 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 189 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 190 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 191 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 192 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 193 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 194 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 195 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 196 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 197 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 198 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 199 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 200 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 201 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 202 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 203 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 204 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 205 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 206 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 207 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_236625 | 3300042612 | Bacteria | 7099 |
| 2 | Ga0562379_0402 | 3300056790 | Unclassified | 96507 |
| 3 | Ga0562378_0056 | 3300056814 | Bacteria | 330468 |
| 4 | Ga0562376_0591 | 3300056857 | Bacteria | 62411 |
| 5 | Ga0562376_0843 | 3300056857 | Bacteria | 48926 |
| 6 | Ga0562374_1701 | 3300057007 | Unclassified | 24302 |
| 7 | Ga0123357_10008027 | 3300009784 | Bacteria | 13132 |
| 8 | Ga0123356_10006241 | 3300010049 | Bacteria | 12040 |
| 9 | Ga0160464_101324 | 3300012805 | Unclassified | 9197 |
| 10 | Ga0466710_114090 | 3300042613 | Bacteria | 6718 |
| 11 | Ga0466718_050676 | 3300042617 | Bacteria | 3835 |
| 12 | Ga0466723_097381 | 3300042618 | Bacteria | 2013 |
| 13 | Ga0466728_448394 | 3300042620 | Bacteria | 23247 |
| 14 | Ga0466693_218291 | 3300042592 | Bacteria | 114325 |
| 15 | Ga0123357_10003224 | 3300009784 | Bacteria | 18583 |
| 16 | Ga0466730_047792 | 3300042625 | Bacteria | 11676 |
| 17 | Ga0466703_154941 | 3300042636 | Bacteria | 85625 |
| 18 | Ga0466703_282486 | 3300042636 | Bacteria | 29799 |
| 19 | Ga0466704_224392 | 3300042643 | Bacteria | 98795 |
| 20 | Ga0466704_460534 | 3300042643 | Bacteria | 24087 |
| 21 | Ga0466727_014598 | 3300042655 | Bacteria | 2727 |
| 22 | Ga0466727_231247 | 3300042655 | Bacteria | 8915 |
| 23 | Ga0466705_308494 | 3300042612 | Bacteria | 9715 |
| 24 | Ga0562379_0149 | 3300056790 | Bacteria | 210994 |
| 25 | Ga0562375_1433 | 3300056856 | Unclassified | 32359 |
| 26 | Ga0562376_0050 | 3300056857 | Bacteria | 302526 |
| 27 | Ga0562376_0559 | 3300056857 | Bacteria | 65453 |
| 28 | Ga0123356_10000018 | 3300010049 | Bacteria | 184445 |
| 29 | Ga0123356_10000060 | 3300010049 | Bacteria | 114492 |
| 30 | Ga0123353_10006264 | 3300010167 | Bacteria | 15821 |
| 31 | Ga0123353_10065471 | 3300010167 | Bacteria | 5834 |
| 32 | Ga0466705_505129 | 3300042612 | Bacteria | 3563 |
| 33 | Ga0466723_036599 | 3300042618 | Bacteria | 10445 |
| 34 | Ga0466726_278994 | 3300042619 | Bacteria | 2406 |
| 35 | Ga0466728_480864 | 3300042620 | Bacteria | 18384 |
| 36 | Ga0160441_100149 | 3300012825 | Bacteria | 75675 |
| 37 | Ga0160435_1000160 | 3300012857 | Bacteria | 35700 |
| 38 | Ga0466693_028471 | 3300042592 | Bacteria | 150342 |
| 39 | Ga0466691_204771 | 3300042593 | Bacteria | 10627 |
| 40 | Ga0466707_029198 | 3300042601 | Bacteria | 75924 |
| 41 | Ga0466707_098458 | 3300042601 | Bacteria | 2719 |
| 42 | Ga0466707_414636 | 3300042601 | Bacteria | 5194 |
| 43 | Ga0466713_041817 | 3300042602 | Bacteria | 31137 |
| 44 | Ga0466713_047200 | 3300042602 | Bacteria | 14547 |
| 45 | Ga0466704_425431 | 3300042643 | Bacteria | 4450 |
| 46 | Ga0466708_136838 | 3300042652 | Bacteria | 36246 |
| 47 | Ga0466708_447943 | 3300042652 | Bacteria | 5044 |
| 48 | Ga0466733_052807 | 3300042659 | Bacteria | 19875 |
| 49 | Ga0466733_186866 | 3300042659 | Bacteria | 153934 |
| 50 | Ga0562377_0107 | 3300056842 | Bacteria | 267817 |
| 51 | Ga0562375_0039 | 3300056856 | Bacteria | 581627 |
| 52 | Ga0562376_0344 | 3300056857 | Bacteria | 90240 |
| 53 | Ga0123356_10000270 | 3300010049 | Bacteria | 59436 |
| 54 | Ga0466715_081297 | 3300042616 | Bacteria | 107795 |
| 55 | Ga0160460_101596 | 3300012845 | Unclassified | 7105 |
| 56 | Ga0466706_171699 | 3300042599 | Bacteria | 13685 |
| 57 | Ga0466719_054841 | 3300042606 | Bacteria | 25243 |
| 58 | Ga0466719_299139 | 3300042606 | Bacteria | 7928 |
| 59 | Ga0123357_10000457 | 3300009784 | Bacteria | 39518 |
| 60 | Ga0562378_0214 | 3300056814 | Unclassified | 138321 |
| 61 | Ga0562377_0009 | 3300056842 | Bacteria | 1580355 |
| 62 | Ga0562377_0990 | 3300056842 | Bacteria | 35443 |
| 63 | Ga0562375_0028 | 3300056856 | Bacteria | 708255 |
| 64 | Ga0562375_1483 | 3300056856 | Bacteria | 31413 |
| 65 | Ga0562376_1556 | 3300056857 | Unclassified | 31569 |
| 66 | Ga0562376_5096 | 3300056857 | Unclassified | 9341 |
| 67 | Ga0123357_10142004 | 3300009784 | Bacteria | 2947 |
| 68 | Ga0466715_215397 | 3300042616 | Bacteria | 6759 |
| 69 | Ga0466729_163048 | 3300042621 | Bacteria | 3705 |
| 70 | Ga0160432_101128 | 3300012818 | Bacteria | 9923 |
| 71 | Ga0160469_100956 | 3300012824 | Bacteria | 9454 |
| 72 | Ga0160443_100331 | 3300012848 | Bacteria | 43686 |
| 73 | Ga0160435_1005814 | 3300012857 | Bacteria | 2767 |
| 74 | Ga0466706_075155 | 3300042599 | Bacteria | 8738 |
| 75 | Ga0466713_030111 | 3300042602 | Bacteria | 26577 |
| 76 | Ga0466716_007623 | 3300042605 | Bacteria | 21316 |
| 77 | JGI24705J35276_12235802 | 3300002504 | Bacteria | 6996 |
| 78 | Ga0123357_10000060 | 3300009784 | Bacteria | 86303 |
| 79 | Ga0466730_060072 | 3300042625 | Bacteria | 33699 |
| 80 | Ga0466703_103283 | 3300042636 | Bacteria | 41411 |
| 81 | Ga0466724_27823 | 3300042649 | Bacteria | 4011 |
| 82 | Ga0562375_0003 | 3300056856 | Bacteria | 3519784 |
| 83 | Ga0562375_0295 | 3300056856 | Bacteria | 125606 |
| 84 | Ga0562376_0014 | 3300056857 | Bacteria | 651340 |
| 85 | Ga0562376_0017 | 3300056857 | Bacteria | 512858 |
| 86 | Ga0562376_1066 | 3300056857 | Bacteria | 41107 |
| 87 | Ga0562376_4695 | 3300056857 | Unclassified | 10682 |
| 88 | Ga0562374_0040 | 3300057007 | Bacteria | 642660 |
| 89 | Ga0123356_10000589 | 3300010049 | Bacteria | 40398 |
| 90 | Ga0123356_10017904 | 3300010049 | Bacteria | 6731 |
| 91 | Ga0123354_10001229 | 3300010882 | Bacteria | 30337 |
| 92 | Ga0160442_101000 | 3300012806 | Bacteria | 3894 |
| 93 | Ga0160452_100091 | 3300012834 | Bacteria | 119942 |
| 94 | Ga0466696_301265 | 3300042596 | Bacteria | 5191 |
| 95 | Ga0466707_297878 | 3300042601 | Bacteria | 29546 |
| 96 | Ga0466713_101616 | 3300042602 | Bacteria | 503322 |
| 97 | JGI24699J35502_11128394 | 3300002509 | Bacteria | 4401 |
| 98 | JGI24699J35502_11134044 | 3300002509 | Bacteria | 26547 |
| 99 | Ga0072941_1022844 | 3300005201 | Bacteria | 33498 |
| 100 | Ga0123357_10000793 | 3300009784 | Bacteria | 31979 |
| 101 | Ga0123357_10002981 | 3300009784 | Bacteria | 19160 |
| 102 | Ga0466703_230474 | 3300042636 | Bacteria | 13370 |
| 103 | Ga0466704_612816 | 3300042643 | Bacteria | 4522 |
| 104 | Ga0466724_66581 | 3300042649 | Bacteria | 665985 |
| 105 | Ga0466727_168193 | 3300042655 | Bacteria | 3588 |
| 106 | Ga0562378_0226 | 3300056814 | Bacteria | 131582 |
| 107 | Ga0123354_10012498 | 3300010882 | Bacteria | 13161 |
| 108 | Ga0466715_401782 | 3300042616 | Bacteria | 4075 |
| 109 | Ga0466723_177586 | 3300042618 | Bacteria | 31384 |
| 110 | Ga0466728_197975 | 3300042620 | Bacteria | 65109 |
| 111 | Ga0466729_031845 | 3300042621 | Bacteria | 11771 |
| 112 | Ga0160432_100027 | 3300012818 | Bacteria | 254467 |
| 113 | Ga0160446_100049 | 3300012835 | Bacteria | 126519 |
| 114 | Ga0160430_102116 | 3300012852 | Unclassified | 6548 |
| 115 | Ga0160457_1001970 | 3300012858 | Bacteria | 4859 |
| 116 | Ga0160436_1000043 | 3300012861 | Bacteria | 69783 |
| 117 | Ga0466696_118881 | 3300042596 | Bacteria | 3307 |
| 118 | Ga0466707_031682 | 3300042601 | Bacteria | 15474 |
| 119 | Ga0466713_054471 | 3300042602 | Bacteria | 15127 |
| 120 | Ga0466713_089541 | 3300042602 | Bacteria | 7573 |
| 121 | Ga0466719_032737 | 3300042606 | Bacteria | 46378 |
| 122 | Ga0466703_081033 | 3300042636 | Bacteria | 68460 |
| 123 | Ga0466703_092170 | 3300042636 | Bacteria | 13029 |
| 124 | Ga0466705_101507 | 3300042612 | Bacteria | 2000 |
| 125 | Ga0562379_0267 | 3300056790 | Bacteria | 136214 |
| 126 | Ga0562379_0706 | 3300056790 | Unclassified | 56284 |
| 127 | Ga0562377_0171 | 3300056842 | Bacteria | 177929 |
| 128 | Ga0562375_0370 | 3300056856 | Bacteria | 100886 |
| 129 | Ga0562376_1702 | 3300056857 | Bacteria | 29625 |
| 130 | Ga0562374_0005 | 3300057007 | Bacteria | 2987673 |
| 131 | Ga0466711_207306 | 3300042615 | Bacteria | 34540 |
| 132 | Ga0466711_349245 | 3300042615 | Bacteria | 6212 |
| 133 | Ga0466718_059312 | 3300042617 | Bacteria | 8485 |
| 134 | Ga0160472_100018 | 3300012839 | Bacteria | 365803 |
| 135 | Ga0160445_100043 | 3300012847 | Bacteria | 156279 |
| 136 | Ga0415639_016003 | 3300038395 | Bacteria | 3799 |
| 137 | Ga0466696_160085 | 3300042596 | Bacteria | 32772 |
| 138 | Ga0466700_466513 | 3300042600 | Bacteria | 7011 |
| 139 | Ga0466707_080865 | 3300042601 | Bacteria | 320076 |
| 140 | Ga0466716_241108 | 3300042605 | Bacteria | 14653 |
| 141 | Ga0466716_503333 | 3300042605 | Bacteria | 3056 |
| 142 | Ga0466719_461092 | 3300042606 | Bacteria | 5160 |
| 143 | Ga0466722_115391 | 3300042609 | Bacteria | 8699 |
| 144 | Ga0466722_157638 | 3300042609 | Bacteria | 26308 |
| 145 | JGI24699J35502_11132310 | 3300002509 | Unclassified | 6672 |
| 146 | Ga0072940_1005053 | 3300005200 | Bacteria | 9015 |
| 147 | Ga0466730_043082 | 3300042625 | Bacteria | 8009 |
| 148 | Ga0466703_379518 | 3300042636 | Bacteria | 2043 |
| 149 | Ga0466704_140814 | 3300042643 | Bacteria | 14631 |
| 150 | Ga0466704_470155 | 3300042643 | Bacteria | 237345 |
| 151 | Ga0466725_267359 | 3300042654 | Bacteria | 4496 |
| 152 | Ga0466733_075551 | 3300042659 | Bacteria | 23886 |
| 153 | Ga0562378_0012 | 3300056814 | Bacteria | 1041899 |
| 154 | Ga0562376_0628 | 3300056857 | Bacteria | 59834 |
| 155 | Ga0466723_080148 | 3300042618 | Bacteria | 2139 |
| 156 | Ga0466706_261061 | 3300042599 | Bacteria | 6514 |
| 157 | Ga0466713_142821 | 3300042602 | Bacteria | 20531 |
| 158 | Ga0466730_061384 | 3300042625 | Bacteria | 7559 |
| 159 | Ga0466703_274121 | 3300042636 | Bacteria | 5746 |
| 160 | Ga0466724_59942 | 3300042649 | Bacteria | 27518 |
| 161 | Ga0466724_64100 | 3300042649 | Bacteria | 707103 |
| 162 | Ga0466725_318825 | 3300042654 | Bacteria | 4838 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00006 | GO:0005524 | ATP binding | MF |
| PF00306 | GO:0015986 | proton motive force-driven ATP synthesis | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.