Protein Family IF09880

Metagenome Isolate
159 Members
45 Samples
154 Scaffolds
418.28 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_097596|Ga0466708_097596_2025_3404
Length
459 aa
Sequence
MARDKKMKKVYLLFFMFLFSIPLFAYIDPGTGSMLFSLLTGVAVTFFFFMKNIMLKIRGGLLLKDGVKKQSSRYSLAIYSEGKQYWNVFKPILEELSRREIPCAYYTSGEDDPGLSASLPPVHAEYIGKGNAAYRFLNFLEADICLMTTPGLDVFQLKRSPGVRRYAHILHMVTDASGYRLFGIDYYDAVLLSGEYQQKDIRTLEKKRGFPEKKLFVIGCTYLDVMAEHLAGLPAKKPGNTKTVLVAPSWGRNGILTRYGLKMLAPLAKSSYHIIIRPHPQSMISEKKTIEALEETLASYANVEWNFDAENLNALSRSDALISDFSGIIFDYAFLFGRPVLYPRFDFDKRPYDMADIEEEAWTFRAVREIGLPLQEESFGDIEKILDGLINAGKERGDTIGRLRGEAYMYPGEAGKRAVDALDIMGKELAKQEQAGYETGGLSGDALKTPGGADTPIVD

📊 Sample Types

Isolate 3.1%
Metagenome 96.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.9%
Kalotermitidae 32.6%
Unclassified 18.6%
Termopsidae 7.0%
Rhinotermitidae 4.7%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
10 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
11 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
12 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
13 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
14 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
15 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
16 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
17 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
18 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
26 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
27 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
31 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
44 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
45 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_016181 3300042612 Bacteria 5573
2 Ga0466705_238167 3300042612 Bacteria 6125
3 Ga0466705_258789 3300042612 Bacteria 2575
4 Ga0466707_411650 3300042601 Bacteria 1683
5 Ga0466720_010554 3300042607 Bacteria 31855
6 Ga0466720_194205 3300042607 Bacteria 1834
7 Ga0068305_10118276 3300005083 Bacteria 19654
8 Ga0123353_10142236 3300010167 Bacteria 3842
9 Ga0466702_072196 3300042635 Bacteria 2766
10 Ga0466702_452913 3300042635 Bacteria 12518
11 Ga0466704_175139 3300042643 Bacteria 8629
12 Ga0466727_254892 3300042655 Bacteria 2700
13 Ga0466712_243131 3300042614 Bacteria 7560
14 Ga0466715_089505 3300042616 Bacteria 7392
15 Ga0466715_210345 3300042616 Bacteria 22767
16 Ga0466715_384104 3300042616 Unclassified 4324
17 Ga0466723_161578 3300042618 Bacteria 33286
18 Ga0466726_280777 3300042619 Bacteria 1719
19 Ga0466726_367598 3300042619 Bacteria 7399
20 Ga0466691_073558 3300042593 Bacteria 5710
21 Ga0466706_163409 3300042599 Bacteria 2305
22 Ga0466713_006115 3300042602 Bacteria 5378
23 Ga0466716_052303 3300042605 Bacteria 12390
24 AustNasuHG_c1002610 3300000089 Bacteria 6505
25 JGI24698J34947_10002074 3300002449 Unclassified 10709
26 Ga0072941_1003366 3300005201 Bacteria 31222
27 Ga0466731_028239 3300042622 Bacteria 18522
28 Ga0466702_097130 3300042635 Bacteria 3414
29 Ga0466702_293698 3300042635 Bacteria 10678
30 Ga0466703_180752 3300042636 Bacteria 53591
31 Ga0466704_146235 3300042643 Bacteria 13774
32 Ga0466704_372927 3300042643 Bacteria 9091
33 Ga0466704_553860 3300042643 Bacteria 4854
34 Ga0466708_172812 3300042652 Bacteria 8994
35 Ga0466705_499500 3300042612 Bacteria 3267
36 Ga0466715_079835 3300042616 Bacteria 11075
37 Ga0466726_009619 3300042619 Bacteria 21834
38 Ga0466728_153531 3300042620 Bacteria 3001
39 Ga0466690_368790 3300042590 Bacteria 1980
40 Ga0466691_068674 3300042593 Unclassified 2679
41 Ga0466694_185830 3300042594 Bacteria 1589
42 Ga0466696_292439 3300042596 Bacteria 2822
43 Ga0466705_067560 3300042612 Bacteria 36632
44 Ga0466713_102604 3300042602 Bacteria 5247
45 Ga0466720_022154 3300042607 Bacteria 3088
46 Ga0466698_072184 3300042610 Bacteria 11052
47 JGI24698J34947_10001835 3300002449 Bacteria 11319
48 Ga0123356_10089293 3300010049 Bacteria 2932
49 Ga0466704_108328 3300042643 Bacteria 14496
50 Ga0466704_187511 3300042643 Bacteria 8398
51 Ga0466708_090443 3300042652 Bacteria 5154
52 Ga0466715_334686 3300042616 Unclassified 4901
53 Ga0466718_115546 3300042617 Bacteria 5492
54 Ga0466726_390209 3300042619 Bacteria 3121
55 Ga0264413_134047 3300024493 Bacteria 5537
56 Ga0466690_114973 3300042590 Bacteria 9717
57 Ga0466692_059088 3300042591 Bacteria 2936
58 Ga0466716_506453 3300042605 Bacteria 5560
59 Ga0466720_044049 3300042607 Bacteria 14732
60 Ga0466720_051715 3300042607 Bacteria 15672
61 JGI24698J34947_10000130 3300002449 Bacteria 27577
62 JGI24698J34947_10071220 3300002449 Unclassified 1669
63 Ga0466735_028376 3300042624 Bacteria 12289
64 Ga0466703_011948 3300042636 Bacteria 11530
65 Ga0466703_232328 3300042636 Bacteria 19965
66 Ga0466704_343105 3300042643 Bacteria 10974
67 Ga0466709_200751 3300042648 Bacteria 6259
68 Ga0466708_359192 3300042652 Bacteria 10465
69 Ga0466712_028588 3300042614 Bacteria 20392
70 Ga0466712_286130 3300042614 Bacteria 1854
71 Ga0466711_224592 3300042615 Bacteria 117488
72 Ga0466715_015628 3300042616 Bacteria 24825
73 Ga0466726_084930 3300042619 Bacteria 21217
74 Ga0466726_425357 3300042619 Bacteria 10250
75 Ga0466728_467866 3300042620 Bacteria 3780
76 Ga0264413_127326 3300024493 Bacteria 19697
77 Ga0466696_391336 3300042596 Bacteria 16280
78 Ga0466699_164862 3300042597 Bacteria 6446
79 Ga0466719_437153 3300042606 Bacteria 18282
80 Ga0466720_211375 3300042607 Bacteria 60841
81 JGI24698J34947_10024623 3300002449 Bacteria 3213
82 JGI24699J35502_11133967 3300002509 Bacteria 21911
83 Ga0466703_007329 3300042636 Bacteria 6085
84 Ga0466703_082590 3300042636 Bacteria 51436
85 Ga0466704_042773 3300042643 Bacteria 13729
86 Ga0466708_097596 3300042652 Bacteria 10049
87 Ga0466708_263468 3300042652 Bacteria 41501
88 Ga0466711_078569 3300042615 Bacteria 5476
89 Ga0466715_057875 3300042616 Bacteria 1478
90 Ga0466715_382797 3300042616 Bacteria 20304
91 Ga0466726_305428 3300042619 Bacteria 4167
92 Ga0466728_009769 3300042620 Bacteria 14362
93 Ga0264413_112834 3300024493 Bacteria 8149
94 Ga0466694_005064 3300042594 Bacteria 6786
95 Ga0466699_047467 3300042597 Bacteria 11573
96 Ga0466705_230922 3300042612 Bacteria 28521
97 Ga0466707_350650 3300042601 Bacteria 2648
98 Ga0466707_411691 3300042601 Unclassified 2615
99 Ga0466720_028491 3300042607 Bacteria 76920
100 Ga0466720_146320 3300042607 Bacteria 7439
101 Ga0466722_152084 3300042609 Bacteria 8014
102 Ga0466708_158260 3300042652 Bacteria 21135
103 Ga0466712_096282 3300042614 Bacteria 2896
104 Ga0466715_060943 3300042616 Bacteria 9404
105 Ga0466726_072653 3300042619 Bacteria 1670
106 Ga0466728_441825 3300042620 Bacteria 7280
107 Ga0466691_178735 3300042593 Bacteria 16367
108 Ga0466705_209789 3300042612 Bacteria 47591
109 Ga0466732_150334 3300042656 Unclassified 30392
110 Ga0466719_397125 3300042606 Bacteria 13416
111 Ga0466720_012895 3300042607 Bacteria 75127
112 Ga0466698_049003 3300042610 Bacteria 1808
113 AustNasuHG_c1014747 3300000089 Bacteria 2649
114 JGI24698J34947_10002677 3300002449 Bacteria 9609
115 JGI24698J34947_10044642 3300002449 Bacteria 2266
116 JGI24695J34938_10020252 3300002450 Bacteria 3278
117 Ga0466703_116010 3300042636 Bacteria 4480
118 Ga0466703_322688 3300042636 Bacteria 3421
119 Ga0466704_141480 3300042643 Bacteria 5189
120 Ga0466708_057654 3300042652 Bacteria 2898
121 Ga0466705_407950 3300042612 Unclassified 1934
122 Ga0466712_236770 3300042614 Bacteria 3567
123 Ga0466711_398183 3300042615 Bacteria 6737
124 Ga0466715_029813 3300042616 Bacteria 45096
125 Ga0466715_062449 3300042616 Bacteria 13496
126 Ga0466715_122541 3300042616 Bacteria 4763
127 Ga0466718_060388 3300042617 Bacteria 28683
128 Ga0466718_092901 3300042617 Bacteria 3573
129 Ga0466723_362687 3300042618 Bacteria 1463
130 Ga0466726_132592 3300042619 Bacteria 2384
131 Ga0264413_108555 3300024493 Bacteria 11278
132 Ga0466694_109251 3300042594 Bacteria 20981
133 Ga0466696_241100 3300042596 Bacteria 7221
134 Ga0466705_231426 3300042612 Unclassified 1346
135 Ga0466707_046532 3300042601 Bacteria 1625
136 Ga0466713_092897 3300042602 Bacteria 20463
137 Ga0466716_500963 3300042605 Bacteria 31431
138 Ga0466719_200181 3300042606 Bacteria 17825
139 Ga0123353_10583508 3300010167 Bacteria 1603
140 Ga0466735_061831 3300042624 Bacteria 2225
141 Ga0466704_120913 3300042643 Bacteria 48720
142 Ga0466704_475978 3300042643 Bacteria 49461
143 Ga0466709_092077 3300042648 Bacteria 1536
144 Ga0466708_035597 3300042652 Unclassified 13848
145 Ga0466708_323130 3300042652 Bacteria 3649
146 Ga0466712_042724 3300042614 Bacteria 11388
147 Ga0466712_211527 3300042614 Bacteria 1513
148 Ga0466711_053417 3300042615 Bacteria 6365
149 Ga0466711_407137 3300042615 Unclassified 1831
150 Ga0466715_374745 3300042616 Unclassified 5319
151 Ga0466726_179389 3300042619 Bacteria 3841
152 Ga0264413_103846 3300024493 Bacteria 19806
153 Ga0264413_104505 3300024493 Bacteria 25126
154 Ga0466691_118331 3300042593 Bacteria 63226

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_211527 Ga0466712_211527_152_1153 333
2 3300002449 JGI24698J34947_10000130 JGI24698J34947_1000013020 374
3 3300042616 Ga0466715_015628 Ga0466715_015628_18127_19299 390
4 3300042594 Ga0466694_185830 Ga0466694_185830_198_1373 391
5 3300024493 Ga0264413_112834 Ga0264413_1128343 394
6 3300042643 Ga0466704_187511 Ga0466704_187511_40_1275 395
7 3300042624 Ga0466735_061831 Ga0466735_061831_200_1390 396
8 3300042648 Ga0466709_200751 Ga0466709_200751_3829_5100 396
9 3300042643 Ga0466704_343105 Ga0466704_343105_5296_6489 397
10 3300042616 Ga0466715_384104 Ga0466715_384104_786_2027 399
11 3300042619 Ga0466726_132592 Ga0466726_132592_849_2054 401
12 3300042635 Ga0466702_293698 Ga0466702_293698_7065_8270 401
13 3300042635 Ga0466702_097130 Ga0466702_097130_783_1991 402
14 3300042605 Ga0466716_052303 Ga0466716_052303_9771_10982 403
15 3300042606 Ga0466719_397125 Ga0466719_397125_12057_13268 403
16 3300042615 Ga0466711_224592 Ga0466711_224592_97173_98441 403
17 3300042616 Ga0466715_382797 Ga0466715_382797_15023_16234 403
18 3300042620 Ga0466728_441825 Ga0466728_441825_5233_6444 403
19 3300042635 Ga0466702_072196 Ga0466702_072196_591_1802 403
20 3300042652 Ga0466708_263468 Ga0466708_263468_36867_38078 403
21 3300042614 Ga0466712_028588 Ga0466712_028588_4742_5983 404
22 3300042614 Ga0466712_286130 Ga0466712_286130_414_1628 404
23 3300042615 Ga0466711_078569 Ga0466711_078569_2532_3746 404
24 3300002449 JGI24698J34947_10002074 JGI24698J34947_100020743 405
25 3300024493 Ga0264413_104505 Ga0264413_1045058 405
26 3300042597 Ga0466699_164862 Ga0466699_164862_4040_5257 405
27 3300042593 Ga0466691_068674 Ga0466691_068674_386_1606 406
28 3300042601 Ga0466707_350650 Ga0466707_350650_1094_2314 406
29 3300002449 JGI24698J34947_10001835 JGI24698J34947_100018359 407
30 3300042607 Ga0466720_022154 Ga0466720_022154_1800_3023 407
31 3300042607 Ga0466720_051715 Ga0466720_051715_1065_2288 407
32 3300042607 Ga0466720_194205 Ga0466720_194205_127_1350 407
33 3300042607 Ga0466720_211375 Ga0466720_211375_34189_35412 407
34 3300042636 Ga0466703_180752 Ga0466703_180752_34433_35656 407
35 iso_pr_bacteria 2819992462 2819994668 407
36 iso_pr_bacteria 2820020240 2820020388 407
37 3300002449 JGI24698J34947_10002677 JGI24698J34947_100026777 408
38 3300002450 JGI24695J34938_10020252 JGI24695J34938_100202523 408
39 3300024493 Ga0264413_108555 Ga0264413_1085552 408
40 3300042607 Ga0466720_146320 Ga0466720_146320_364_1590 408
41 3300042617 Ga0466718_060388 Ga0466718_060388_15601_16827 408
42 3300042635 Ga0466702_452913 Ga0466702_452913_6028_7254 408
43 3300042648 Ga0466709_092077 Ga0466709_092077_262_1488 408
44 3300042610 Ga0466698_049003 Ga0466698_049003_265_1494 409
45 3300042610 Ga0466698_072184 Ga0466698_072184_3915_5144 409
46 3300042614 Ga0466712_042724 Ga0466712_042724_6946_8175 409
47 3300042622 Ga0466731_028239 Ga0466731_028239_2496_3725 409
48 3300042590 Ga0466690_368790 Ga0466690_368790_675_1907 410
49 3300042612 Ga0466705_407950 Ga0466705_407950_605_1837 410
50 3300042615 Ga0466711_053417 Ga0466711_053417_1474_2706 410
51 3300042643 Ga0466704_108328 Ga0466704_108328_8850_10082 410
52 iso_pr_bacteria 2781125692 2781430927 410
53 3300042594 Ga0466694_005064 Ga0466694_005064_3606_4841 411
54 3300042596 Ga0466696_391336 Ga0466696_391336_9084_10319 411
55 3300042597 Ga0466699_047467 Ga0466699_047467_9401_10636 411
56 3300042614 Ga0466712_096282 Ga0466712_096282_1125_2360 411
57 3300042616 Ga0466715_089505 Ga0466715_089505_2794_4029 411
58 3300002449 JGI24698J34947_10044642 JGI24698J34947_100446422 412
59 3300002449 JGI24698J34947_10071220 JGI24698J34947_100712202 412
60 3300010049 Ga0123356_10089293 Ga0123356_100892932 412
61 3300010167 Ga0123353_10583508 Ga0123353_105835082 412
62 3300042594 Ga0466694_109251 Ga0466694_109251_15519_16757 412
63 3300042609 Ga0466722_152084 Ga0466722_152084_5342_6580 412
64 3300042636 Ga0466703_116010 Ga0466703_116010_546_1784 412
65 3300000089 AustNasuHG_c1014747 AustNasuHG_10147473 413
66 3300042607 Ga0466720_012895 Ga0466720_012895_20565_21806 413
67 3300042617 Ga0466718_092901 Ga0466718_092901_1908_3149 413
68 3300042619 Ga0466726_009619 Ga0466726_009619_3649_4890 413
69 3300042643 Ga0466704_120913 Ga0466704_120913_21791_23065 413
70 3300042614 Ga0466712_243131 Ga0466712_243131_4431_5675 414
71 3300042636 Ga0466703_082590 Ga0466703_082590_17148_18392 414
72 3300000089 AustNasuHG_c1002610 AustNasuHG_10026104 415
73 3300002509 JGI24699J35502_11133967 JGI24699J35502_1113396710 415
74 3300042601 Ga0466707_411650 Ga0466707_411650_32_1279 415
75 3300042612 Ga0466705_209789 Ga0466705_209789_21210_22484 415
76 3300042616 Ga0466715_029813 Ga0466715_029813_29813_31060 415
77 3300042616 Ga0466715_062449 Ga0466715_062449_1794_3041 415
78 3300042619 Ga0466726_280777 Ga0466726_280777_122_1369 415
79 3300042656 Ga0466732_150334 Ga0466732_150334_7224_8471 415
80 3300042591 Ga0466692_059088 Ga0466692_059088_1517_2767 416
81 3300042601 Ga0466707_411691 Ga0466707_411691_487_1737 416
82 3300042607 Ga0466720_028491 Ga0466720_028491_50349_51599 416
83 3300042652 Ga0466708_323130 Ga0466708_323130_327_1577 416
84 3300010167 Ga0123353_10142236 Ga0123353_101422363 417
85 3300042606 Ga0466719_437153 Ga0466719_437153_4482_5735 417
86 3300042617 Ga0466718_115546 Ga0466718_115546_481_1734 417
87 iso_pr_bacteria 2781125631 2781267783 417
88 3300042601 Ga0466707_046532 Ga0466707_046532_200_1456 418
89 3300042605 Ga0466716_500963 Ga0466716_500963_13266_14522 418
90 3300042612 Ga0466705_231426 Ga0466705_231426_73_1329 418
91 3300042619 Ga0466726_390209 Ga0466726_390209_1749_3029 418
92 3300002449 JGI24698J34947_10024623 JGI24698J34947_100246231 419
93 3300024493 Ga0264413_103846 Ga0264413_1038466 419
94 3300042615 Ga0466711_407137 Ga0466711_407137_540_1799 419
95 3300042643 Ga0466704_553860 Ga0466704_553860_3582_4841 419
96 3300042599 Ga0466706_163409 Ga0466706_163409_151_1413 420
97 3300042616 Ga0466715_122541 Ga0466715_122541_2447_3709 420
98 3300042602 Ga0466713_092897 Ga0466713_092897_1481_2746 421
99 3300042616 Ga0466715_210345 Ga0466715_210345_7077_8372 421
100 3300024493 Ga0264413_127326 Ga0264413_12732613 422
101 3300024493 Ga0264413_134047 Ga0264413_1340475 422
102 3300042590 Ga0466690_114973 Ga0466690_114973_8191_9459 422
103 3300042619 Ga0466726_305428 Ga0466726_305428_2812_4080 422
104 3300042605 Ga0466716_506453 Ga0466716_506453_4044_5315 423
105 3300042612 Ga0466705_230922 Ga0466705_230922_6064_7335 423
106 3300042620 Ga0466728_009769 Ga0466728_009769_9391_10704 423
107 3300042607 Ga0466720_010554 Ga0466720_010554_17436_18713 425
108 3300042643 Ga0466704_475978 Ga0466704_475978_19268_20545 425
109 3300042607 Ga0466720_044049 Ga0466720_044049_5732_7012 426
110 3300042614 Ga0466712_236770 Ga0466712_236770_52_1332 426
111 3300042624 Ga0466735_028376 Ga0466735_028376_5874_7154 426
112 3300042593 Ga0466691_118331 Ga0466691_118331_34120_35403 427
113 3300042616 Ga0466715_060943 Ga0466715_060943_730_2031 427
114 iso_pr_bacteria 650716099 650878806 428
115 3300005201 Ga0072941_1003366 Ga0072941_100336613 429
116 3300042593 Ga0466691_178735 Ga0466691_178735_4500_5789 429
117 3300042612 Ga0466705_238167 Ga0466705_238167_4510_5799 429
118 3300042615 Ga0466711_398183 Ga0466711_398183_4231_5520 429
119 3300042616 Ga0466715_334686 Ga0466715_334686_1055_2344 429
120 3300042616 Ga0466715_374745 Ga0466715_374745_3743_5032 429
121 3300042612 Ga0466705_499500 Ga0466705_499500_619_1911 430
122 3300042618 Ga0466723_362687 Ga0466723_362687_141_1433 430
123 3300042619 Ga0466726_367598 Ga0466726_367598_4705_6000 431
124 3300042593 Ga0466691_073558 Ga0466691_073558_3206_4507 433
125 3300042612 Ga0466705_016181 Ga0466705_016181_1155_2528 433
126 3300042616 Ga0466715_057875 Ga0466715_057875_33_1334 433
127 3300042619 Ga0466726_072653 Ga0466726_072653_50_1351 433
128 3300042636 Ga0466703_322688 Ga0466703_322688_1655_2956 433
129 3300042652 Ga0466708_172812 Ga0466708_172812_2142_3443 433
130 3300042655 Ga0466727_254892 Ga0466727_254892_759_2060 433
131 3300042602 Ga0466713_006115 Ga0466713_006115_17_1321 434
132 3300042616 Ga0466715_079835 Ga0466715_079835_6084_7388 434
133 3300042636 Ga0466703_011948 Ga0466703_011948_1998_3302 434
134 3300042636 Ga0466703_232328 Ga0466703_232328_14345_15649 434
135 3300042643 Ga0466704_372927 Ga0466704_372927_7326_8630 434
136 3300042596 Ga0466696_241100 Ga0466696_241100_1949_3256 435
137 3300042619 Ga0466726_179389 Ga0466726_179389_2217_3590 437
138 3300042620 Ga0466728_153531 Ga0466728_153531_381_1694 437
139 3300042636 Ga0466703_007329 Ga0466703_007329_4057_5370 437
140 3300042612 Ga0466705_258789 Ga0466705_258789_732_2051 439
141 3300042652 Ga0466708_057654 Ga0466708_057654_1156_2475 439
142 3300042652 Ga0466708_090443 Ga0466708_090443_2810_4129 439
143 3300042643 Ga0466704_042773 Ga0466704_042773_6388_7710 440
144 3300042652 Ga0466708_035597 Ga0466708_035597_1636_2958 440
145 3300042602 Ga0466713_102604 Ga0466713_102604_1553_2878 441
146 3300042619 Ga0466726_425357 Ga0466726_425357_5949_7274 441
147 3300042618 Ga0466723_161578 Ga0466723_161578_21109_22455 442
148 3300005083 Ga0068305_10118276 Ga0068305_101182764 443
149 3300042606 Ga0466719_200181 Ga0466719_200181_7906_9237 443
150 3300042596 Ga0466696_292439 Ga0466696_292439_564_1901 445
151 3300042619 Ga0466726_084930 Ga0466726_084930_19607_20944 445
152 3300042643 Ga0466704_141480 Ga0466704_141480_3790_5127 445
153 3300042643 Ga0466704_146235 Ga0466704_146235_8181_9518 445
154 3300042643 Ga0466704_175139 Ga0466704_175139_945_2282 445
155 3300042652 Ga0466708_359192 Ga0466708_359192_2059_3402 447
156 3300042620 Ga0466728_467866 Ga0466728_467866_795_2144 449
157 3300042652 Ga0466708_158260 Ga0466708_158260_9828_11177 449
158 3300042612 Ga0466705_067560 Ga0466705_067560_28015_29370 451
159 3300042652 Ga0466708_097596 Ga0466708_097596_2025_3404 459

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04464 Glyphos_transf CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase 240 349 0.78

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.