Protein Family IF09843
Metagenome
Isolate
114
Members
39
Samples
110
Scaffolds
320.54
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_047352|Ga0466708_047352_7517_8575
- Length
- 352 aa
- Sequence
- MNKMKTVNPTLPEAQPDRQTNDDEISLLDLFAVLWRHRVMIIVITLVAAVGVAAFSVLSLILPSETSPLPNEYTPQAHMLINNTSSPGGGLSSMLXXXXLGXXASLAGVSVPTGSTFSELAVYLVGSNTLLDAVVDEFGLIERYEIEKFPRFSSREILKENLAAKYDEKSGVFSISFTDIDPVFAQRVVNFCVEYLGGRFNELGIDKNKIEKENLELNISNTYQEIIRLEQESQNLESSVGRGMAGGSLPPVGIELNRLQLELDAQKQIYTQLKIQYEMLKVNMASETPVFQILEYAEVPDMKSGPSRGLICIIVTFAAGFFAVFLAFVLNAVKNIRNDPKAMAIFGKQKDE
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.8%
Kalotermitidae
35.1%
Unclassified
10.8%
Rhinotermitidae
8.1%
Termopsidae
5.4%
Hodotermitidae
2.7%
Taxonomy
Archaea
1
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 12 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 39 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466722_051593 | 3300042609 | Bacteria | 2689 |
| 2 | Ga0264413_100197 | 3300024493 | Bacteria | 8467 |
| 3 | Ga0466692_094876 | 3300042591 | Bacteria | 38787 |
| 4 | Ga0466693_096768 | 3300042592 | Bacteria | 2669 |
| 5 | Ga0466699_331282 | 3300042597 | Bacteria | 10398 |
| 6 | JGI24698J34947_10010889 | 3300002449 | Archaea | 4989 |
| 7 | Ga0072941_1006784 | 3300005201 | Bacteria | 6358 |
| 8 | Ga0466709_335709 | 3300042648 | Bacteria | 7301 |
| 9 | Ga0466708_278139 | 3300042652 | Bacteria | 1801 |
| 10 | Ga0466712_220951 | 3300042614 | Bacteria | 12828 |
| 11 | Ga0466711_239902 | 3300042615 | Bacteria | 6917 |
| 12 | Ga0466726_291854 | 3300042619 | Bacteria | 1719 |
| 13 | Ga0466716_114400 | 3300042605 | Bacteria | 3189 |
| 14 | Ga0466716_265906 | 3300042605 | Bacteria | 2823 |
| 15 | Ga0466719_025223 | 3300042606 | Bacteria | 8914 |
| 16 | Ga0466720_108612 | 3300042607 | Bacteria | 122313 |
| 17 | Ga0466722_086073 | 3300042609 | Bacteria | 5999 |
| 18 | Ga0466722_173285 | 3300042609 | Bacteria | 2004 |
| 19 | Ga0466690_232311 | 3300042590 | Bacteria | 1450 |
| 20 | Ga0466696_068182 | 3300042596 | Bacteria | 17044 |
| 21 | Ga0466699_009862 | 3300042597 | Bacteria | 72863 |
| 22 | Ga0466699_212781 | 3300042597 | Bacteria | 2832 |
| 23 | JGI24698J34947_10001024 | 3300002449 | Bacteria | 14386 |
| 24 | JGI24698J34947_10017332 | 3300002449 | Bacteria | 3904 |
| 25 | JGI24695J34938_10000176 | 3300002450 | Bacteria | 59497 |
| 26 | Ga0072940_1001679 | 3300005200 | Bacteria | 5190 |
| 27 | Ga0072940_1067858 | 3300005200 | Bacteria | 2836 |
| 28 | Ga0466703_090917 | 3300042636 | Bacteria | 7238 |
| 29 | Ga0466729_040670 | 3300042621 | Bacteria | 2353 |
| 30 | Ga0466732_249542 | 3300042656 | Bacteria | 7455 |
| 31 | Ga0466720_014975 | 3300042607 | Unclassified | 1306 |
| 32 | Ga0466722_185814 | 3300042609 | Bacteria | 2799 |
| 33 | Ga0264413_108438 | 3300024493 | Bacteria | 8409 |
| 34 | Ga0466692_127891 | 3300042591 | Bacteria | 34821 |
| 35 | Ga0068305_10009355 | 3300005083 | Unclassified | 3933 |
| 36 | Ga0072941_1003758 | 3300005201 | Bacteria | 29896 |
| 37 | Ga0072941_1066609 | 3300005201 | Bacteria | 3901 |
| 38 | Ga0072941_1093782 | 3300005201 | Bacteria | 4239 |
| 39 | Ga0466705_139346 | 3300042612 | Bacteria | 2870 |
| 40 | Ga0466735_023101 | 3300042624 | Bacteria | 33516 |
| 41 | Ga0466708_004477 | 3300042652 | Bacteria | 6227 |
| 42 | Ga0466708_012439 | 3300042652 | Bacteria | 14709 |
| 43 | Ga0466708_243019 | 3300042652 | Bacteria | 6394 |
| 44 | Ga0466708_454010 | 3300042652 | Bacteria | 3033 |
| 45 | Ga0466715_035903 | 3300042616 | Bacteria | 4668 |
| 46 | Ga0466715_206215 | 3300042616 | Bacteria | 2993 |
| 47 | Ga0466729_073493 | 3300042621 | Bacteria | 3881 |
| 48 | Ga0466698_288091 | 3300042610 | Bacteria | 18185 |
| 49 | Ga0264413_133042 | 3300024493 | Bacteria | 4157 |
| 50 | Ga0466699_053642 | 3300042597 | Bacteria | 8275 |
| 51 | Ga0466699_178832 | 3300042597 | Bacteria | 3985 |
| 52 | 2230930326 | 2228664001 | Bacteria | 1723 |
| 53 | Ga0466729_260486 | 3300042621 | Bacteria | 1285 |
| 54 | Ga0466731_116953 | 3300042622 | Bacteria | 1464 |
| 55 | Ga0466704_538978 | 3300042643 | Bacteria | 6019 |
| 56 | Ga0466720_203691 | 3300042607 | Bacteria | 24981 |
| 57 | Ga0466690_158606 | 3300042590 | Bacteria | 7320 |
| 58 | Ga0466692_086464 | 3300042591 | Bacteria | 23953 |
| 59 | Ga0466692_115843 | 3300042591 | Bacteria | 1869 |
| 60 | Ga0466691_030795 | 3300042593 | Bacteria | 1774 |
| 61 | AustNasuHG_c1028276 | 3300000089 | Bacteria | 1679 |
| 62 | JGI24698J34947_10004568 | 3300002449 | Bacteria | 7543 |
| 63 | Ga0072941_1006786 | 3300005201 | Bacteria | 3197 |
| 64 | Ga0072941_1057237 | 3300005201 | Bacteria | 4151 |
| 65 | Ga0466705_298454 | 3300042612 | Bacteria | 1888 |
| 66 | Ga0466704_021210 | 3300042643 | Unclassified | 9587 |
| 67 | Ga0466708_107056 | 3300042652 | Bacteria | 14386 |
| 68 | Ga0466732_226183 | 3300042656 | Bacteria | 2933 |
| 69 | Ga0466713_001221 | 3300042602 | Bacteria | 8347 |
| 70 | Ga0466720_044075 | 3300042607 | Bacteria | 5708 |
| 71 | Ga0264413_144419 | 3300024493 | Bacteria | 1270 |
| 72 | Ga0466692_016215 | 3300042591 | Bacteria | 9334 |
| 73 | Ga0466694_311242 | 3300042594 | Bacteria | 7219 |
| 74 | AustNasuHG_c1007240 | 3300000089 | Bacteria | 3948 |
| 75 | Ga0072941_1019696 | 3300005201 | Bacteria | 12664 |
| 76 | Ga0466704_435309 | 3300042643 | Bacteria | 3497 |
| 77 | Ga0466709_064415 | 3300042648 | Bacteria | 19392 |
| 78 | Ga0466708_244586 | 3300042652 | Bacteria | 15884 |
| 79 | Ga0466711_465584 | 3300042615 | Bacteria | 28091 |
| 80 | Ga0466715_049250 | 3300042616 | Bacteria | 14141 |
| 81 | Ga0466718_138325 | 3300042617 | Bacteria | 9650 |
| 82 | Ga0466723_094798 | 3300042618 | Bacteria | 7160 |
| 83 | Ga0466698_355318 | 3300042610 | Bacteria | 1232 |
| 84 | Ga0466690_422443 | 3300042590 | Bacteria | 4067 |
| 85 | Ga0466691_032097 | 3300042593 | Bacteria | 3999 |
| 86 | Ga0466696_249278 | 3300042596 | Bacteria | 2818 |
| 87 | Ga0466699_012743 | 3300042597 | Bacteria | 1036 |
| 88 | Ga0466699_239371 | 3300042597 | Bacteria | 3954 |
| 89 | JGI24698J34947_10004760 | 3300002449 | Bacteria | 7419 |
| 90 | Ga0072941_1036414 | 3300005201 | Bacteria | 8312 |
| 91 | Ga0466705_464080 | 3300042612 | Bacteria | 1788 |
| 92 | Ga0466712_018602 | 3300042614 | Bacteria | 54161 |
| 93 | Ga0466712_046818 | 3300042614 | Bacteria | 19755 |
| 94 | Ga0466711_494591 | 3300042615 | Bacteria | 2278 |
| 95 | Ga0466718_104292 | 3300042617 | Bacteria | 1025 |
| 96 | Ga0466723_271667 | 3300042618 | Bacteria | 3467 |
| 97 | Ga0466729_146473 | 3300042621 | Unclassified | 1185 |
| 98 | Ga0466732_324113 | 3300042656 | Bacteria | 15181 |
| 99 | Ga0466706_075529 | 3300042599 | Bacteria | 7400 |
| 100 | Ga0466716_097408 | 3300042605 | Bacteria | 2379 |
| 101 | Ga0466698_198836 | 3300042610 | Unclassified | 1769 |
| 102 | Ga0466699_063608 | 3300042597 | Bacteria | 7149 |
| 103 | Ga0466699_133710 | 3300042597 | Bacteria | 7851 |
| 104 | JGI24695J34938_10001395 | 3300002450 | Bacteria | 20646 |
| 105 | Ga0072941_1019697 | 3300005201 | Bacteria | 16567 |
| 106 | Ga0072941_1034139 | 3300005201 | Bacteria | 10029 |
| 107 | Ga0072941_1040561 | 3300005201 | Bacteria | 1348 |
| 108 | Ga0466708_047352 | 3300042652 | Bacteria | 8783 |
| 109 | Ga0466712_262629 | 3300042614 | Bacteria | 2222 |
| 110 | Ga0466729_156410 | 3300042621 | Bacteria | 3662 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13807 | GNVR | G-rich domain on putative tyrosine kinase | 258 | 330 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.