Protein Family IF09815

Metagenome Isolate
145 Members
41 Samples
138 Scaffolds
225.68 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_007473|Ga0466708_007473_213_920
Length
235 aa
Sequence
LPAWRRQEVRPVRILVVEDNVRLNELVVKKLKSENYSVDACLRGDDAMDCIACAEYDALILDVMLPGMSGLDVLRAMRGKNDRTPVLLLTARDGVSDRVGGLDAGADDYLVKPFAFDELTARVRALIRRGTNAVGDVFTAADLSVDCSSRKVTRGGQEIELSSREFAILEYLVRNKGIVLSRRAIGNHIWNYDYEGESNIIDVYIRNLRRKMDDTEETKLIRTVRGAGYVLREDV

📊 Sample Types

Isolate 4.8%
Metagenome 95.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.0%
Kalotermitidae 26.8%
Unclassified 17.1%
Rhinotermitidae 7.3%
Passalidae 7.3%
Dytiscidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
3 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
4 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
5 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
6 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
7 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 2820565217 Unclassified Firmicutes Emb289P3bin51 Isolate Unclassified
12 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
13 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
14 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
15 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
16 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
17 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
20 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
21 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
24 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
25 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
26 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
29 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
30 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
33 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
35 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
41 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10001615 3300010049 Bacteria 24719
2 Ga0123356_10128683 3300010049 Bacteria 2477
3 Ga0123353_10105499 3300010167 Bacteria 4541
4 Ga0123353_10125552 3300010167 Bacteria 4123
5 Ga0123353_10292684 3300010167 Bacteria 2491
6 Ga0123353_10444222 3300010167 Bacteria 1912
7 Ga0123353_10730562 3300010167 Bacteria 1383
8 Ga0123354_10317828 3300010882 Unclassified 1442
9 Ga0123354_10445166 3300010882 Bacteria 1054
10 Ga0466725_061981 3300042654 Bacteria 3138
11 Ga0466707_179582 3300042601 Bacteria 2546
12 Ga0466713_092105 3300042602 Bacteria 2792
13 Ga0466718_133288 3300042617 Bacteria 3267
14 Ga0466723_283907 3300042618 Bacteria 3057
15 Ga0466696_267156 3300042596 Bacteria 3100
16 Ga0123353_10042089 3300010167 Unclassified 7221
17 Ga0123353_10068826 3300010167 Bacteria 5685
18 Ga0123353_10580257 3300010167 Bacteria 1609
19 Ga0123353_10623699 3300010167 Bacteria 1534
20 Ga0123353_10762015 3300010167 Unclassified 1345
21 Ga0123353_10803201 3300010167 Unclassified 1298
22 Ga0123353_11189516 3300010167 Unclassified 1002
23 Ga0123353_11313860 3300010167 Unclassified 938
24 2227581585 2225789004 Bacteria 2505
25 IMNBGM34_c009385 3300000036 Bacteria 1240
26 JGI24702J35022_10022479 3300002462 Bacteria 3413
27 Ga0466722_203851 3300042609 Bacteria 39655
28 Ga0466715_428383 3300042616 Bacteria 29820
29 Ga0466696_450971 3300042596 Bacteria 5404
30 Ga0466696_456435 3300042596 Bacteria 1084
31 Ga0123353_10002035 3300010167 Bacteria 24964
32 Ga0123353_10021887 3300010167 Bacteria 9611
33 Ga0123353_10143515 3300010167 Bacteria 3822
34 Ga0123353_10144811 3300010167 Bacteria 3801
35 Ga0123353_10173383 3300010167 Bacteria 3422
36 Ga0123353_10185359 3300010167 Bacteria 3291
37 Ga0123353_10216990 3300010167 Bacteria 2995
38 Ga0123353_10271502 3300010167 Bacteria 2612
39 Ga0123353_10336400 3300010167 Unclassified 2282
40 Ga0123353_10438363 3300010167 Bacteria 1928
41 Ga0123353_10559460 3300010167 Bacteria 1647
42 Ga0123353_10647952 3300010167 Bacteria 1496
43 Ga0123353_10691736 3300010167 Bacteria 1433
44 Ga0123353_11642317 3300010167 Bacteria 809
45 IMNBL1DRAFT_c0005025 3300000062 Bacteria 7718
46 JGI24702J35022_10146026 3300002462 Bacteria 1324
47 Ga0466697_098602 3300042611 Bacteria 1001
48 Ga0466703_124176 3300042636 Bacteria 1421
49 Ga0466709_288539 3300042648 Bacteria 3566
50 Ga0466708_007473 3300042652 Bacteria 1178
51 Ga0466725_385498 3300042654 Bacteria 1952
52 Ga0466707_408988 3300042601 Bacteria 7030
53 Ga0466691_197357 3300042593 Bacteria 6055
54 Ga0466696_144158 3300042596 Bacteria 3515
55 Ga0466696_494836 3300042596 Bacteria 5969
56 Ga0123353_10071753 3300010167 Unclassified 5564
57 Ga0123353_10245863 3300010167 Bacteria 2776
58 Ga0123353_10389318 3300010167 Bacteria 2080
59 Ga0123353_10562993 3300010167 Bacteria 1640
60 Ga0123353_11121884 3300010167 Bacteria 1041
61 Ga0123353_11196058 3300010167 Bacteria 998
62 JGI24702J35022_10005899 3300002462 Bacteria 7121
63 JGI24702J35022_10074370 3300002462 Bacteria 1834
64 JGI24696J40584_12882809 3300002834 Unclassified 1092
65 Ga0466704_422929 3300042643 Bacteria 2071
66 Ga0466708_215932 3300042652 Bacteria 1874
67 Ga0466700_083659 3300042600 Bacteria 1212
68 Ga0123356_10017055 3300010049 Bacteria 6912
69 Ga0123353_10004247 3300010167 Unclassified 18401
70 Ga0123353_10115328 3300010167 Bacteria 4324
71 Ga0123353_10288017 3300010167 Unclassified 2517
72 Ga0123353_10853593 3300010167 Bacteria 1247
73 Ga0123353_10929951 3300010167 Bacteria 1179
74 Ga0466705_207009 3300042612 Bacteria 9633
75 Ga0466714_039860 3300042603 Bacteria 4990
76 Ga0123357_10482923 3300009784 Bacteria 1045
77 Ga0123353_10162850 3300010167 Bacteria 3549
78 Ga0123353_10175040 3300010167 Bacteria 3403
79 Ga0123353_10206687 3300010167 Bacteria 3083
80 Ga0123353_10240731 3300010167 Bacteria 2811
81 Ga0123353_10255336 3300010167 Bacteria 2711
82 Ga0123353_10436090 3300010167 Bacteria 1935
83 Ga0123353_10568987 3300010167 Bacteria 1629
84 Ga0123353_10792026 3300010167 Bacteria 1311
85 Ga0123353_10819287 3300010167 Bacteria 1282
86 Ga0123353_10889774 3300010167 Bacteria 1214
87 Ga0123353_11033792 3300010167 Bacteria 1099
88 Ga0123354_10064011 3300010882 Bacteria 5397
89 Ga0123354_10251052 3300010882 Bacteria 1792
90 Ga0123354_10252298 3300010882 Unclassified 1784
91 Ga0123354_10309238 3300010882 Bacteria 1479
92 Ga0123354_10570490 3300010882 Bacteria 843
93 Ga0466703_027901 3300042636 Bacteria 1523
94 Ga0466714_010594 3300042603 Bacteria 1599
95 Ga0466717_030751 3300042604 Bacteria 17571
96 Ga0466721_029082 3300042608 Bacteria 1520
97 Ga0466728_262078 3300042620 Bacteria 4738
98 Ga0466693_065450 3300042592 Bacteria 8285
99 Ga0466696_062058 3300042596 Bacteria 4047
100 Ga0123353_10006174 3300010167 Bacteria 15912
101 Ga0123353_10068614 3300010167 Unclassified 5694
102 Ga0123353_10472511 3300010167 Bacteria 1838
103 Ga0123353_10588504 3300010167 Bacteria 1594
104 Ga0123353_10613687 3300010167 Unclassified 1551
105 Ga0123353_10677498 3300010167 Bacteria 1453
106 Ga0123353_10736056 3300010167 Bacteria 1376
107 Ga0123353_11112776 3300010167 Bacteria 1047
108 Ga0123354_10043917 3300010882 Bacteria 6863
109 Ga0123354_10342358 3300010882 Unclassified 1346
110 IMNBL1DRAFT_c0000032 3300000062 Bacteria 125696
111 IMNBL1DRAFT_c0036797 3300000062 Bacteria 1704
112 Ga0466729_204461 3300042621 Bacteria 1063
113 Ga0466707_156341 3300042601 Bacteria 12094
114 Ga0466717_068222 3300042604 Bacteria 1487
115 Ga0466717_239799 3300042604 Unclassified 2118
116 Ga0466691_069176 3300042593 Bacteria 7736
117 Ga0123356_10046683 3300010049 Bacteria 4030
118 Ga0123353_10255712 3300010167 Bacteria 2709
119 Ga0123353_10442761 3300010167 Bacteria 1916
120 Ga0123353_10450073 3300010167 Bacteria 1896
121 Ga0123353_10464100 3300010167 Bacteria 1859
122 Ga0123353_11483688 3300010167 Unclassified 865
123 Ga0123354_10421474 3300010882 Bacteria 1109
124 2227535723 2225789004 Bacteria 58482
125 IMNBL1DRAFT_c0000141 3300000062 Bacteria 64520
126 IMNBL1DRAFT_c0001530 3300000062 Bacteria 17231
127 IMNBL1DRAFT_c0006687 3300000062 Bacteria 6245
128 Ga0466729_267814 3300042621 Bacteria 17332
129 Ga0466731_232161 3300042622 Bacteria 1769
130 Ga0466703_084662 3300042636 Bacteria 2107
131 Ga0466703_351065 3300042636 Bacteria 4132
132 Ga0466704_032220 3300042643 Bacteria 1960
133 Ga0466722_084624 3300042609 Bacteria 4651
134 Ga0466711_255836 3300042615 Bacteria 1723
135 Ga0466692_183549 3300042591 Bacteria 2237
136 Ga0466691_119497 3300042593 Bacteria 2403
137 Ga0466696_057995 3300042596 Bacteria 5528
138 Ga0466696_230413 3300042596 Bacteria 6013

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10288017 Ga0123353_102880172 208
2 3300042609 Ga0466722_084624 Ga0466722_084624_2040_2669 209
3 3300010167 Ga0123353_10021887 Ga0123353_100218878 214
4 3300010882 Ga0123354_10317828 Ga0123354_103178282 214
5 3300042608 Ga0466721_029082 Ga0466721_029082_218_874 218
6 3300042596 Ga0466696_062058 Ga0466696_062058_2595_3257 220
7 2225789004 2227535723 2228052007 223
8 2225789004 2227581585 2228133873 223
9 3300002462 JGI24702J35022_10146026 JGI24702J35022_101460262 223
10 3300010167 Ga0123353_10175040 Ga0123353_101750404 223
11 3300010167 Ga0123353_10691736 Ga0123353_106917361 223
12 3300042600 Ga0466700_083659 Ga0466700_083659_24_695 223
13 3300042601 Ga0466707_156341 Ga0466707_156341_6585_7256 223
14 3300042601 Ga0466707_408988 Ga0466707_408988_1868_2539 223
15 3300042603 Ga0466714_010594 Ga0466714_010594_102_773 223
16 3300042603 Ga0466714_039860 Ga0466714_039860_2149_2820 223
17 3300042604 Ga0466717_030751 Ga0466717_030751_3212_3883 223
18 3300042604 Ga0466717_239799 Ga0466717_239799_1348_2019 223
19 3300042611 Ga0466697_098602 Ga0466697_098602_259_930 223
20 3300042622 Ga0466731_232161 Ga0466731_232161_538_1209 223
21 3300042652 Ga0466708_215932 Ga0466708_215932_765_1436 223
22 3300042654 Ga0466725_061981 Ga0466725_061981_800_1471 223
23 iso_pr_bacteria 2820340373 2820341055 223
24 iso_pr_bacteria 2820464928 2820465371 223
25 iso_pr_bacteria 2820565217 2820566289 223
26 iso_pr_bacteria 2820576413 2820577081 223
27 iso_pr_bacteria 2820813074 2820813120 223
28 3300000062 IMNBL1DRAFT_c0000032 IMNBL1DRAFT_000003216 224
29 3300000062 IMNBL1DRAFT_c0000141 IMNBL1DRAFT_000014140 224
30 3300000062 IMNBL1DRAFT_c0001530 IMNBL1DRAFT_000153015 224
31 3300000062 IMNBL1DRAFT_c0005025 IMNBL1DRAFT_00050253 224
32 3300000062 IMNBL1DRAFT_c0006687 IMNBL1DRAFT_00066874 224
33 3300000062 IMNBL1DRAFT_c0036797 IMNBL1DRAFT_00367973 224
34 3300002462 JGI24702J35022_10005899 JGI24702J35022_100058994 224
35 3300002462 JGI24702J35022_10022479 JGI24702J35022_100224795 224
36 3300002462 JGI24702J35022_10074370 JGI24702J35022_100743702 224
37 3300002834 JGI24696J40584_12882809 JGI24696J40584_128828092 224
38 3300009784 Ga0123357_10482923 Ga0123357_104829232 224
39 3300010049 Ga0123356_10001615 Ga0123356_1000161520 224
40 3300010049 Ga0123356_10017055 Ga0123356_100170557 224
41 3300010049 Ga0123356_10046683 Ga0123356_100466832 224
42 3300010049 Ga0123356_10128683 Ga0123356_101286833 224
43 3300010167 Ga0123353_10002035 Ga0123353_1000203526 224
44 3300010167 Ga0123353_10004247 Ga0123353_1000424715 224
45 3300010167 Ga0123353_10006174 Ga0123353_100061747 224
46 3300010167 Ga0123353_10042089 Ga0123353_100420892 224
47 3300010167 Ga0123353_10068614 Ga0123353_100686147 224
48 3300010167 Ga0123353_10071753 Ga0123353_100717533 224
49 3300010167 Ga0123353_10105499 Ga0123353_101054996 224
50 3300010167 Ga0123353_10115328 Ga0123353_101153282 224
51 3300010167 Ga0123353_10125552 Ga0123353_101255524 224
52 3300010167 Ga0123353_10162850 Ga0123353_101628502 224
53 3300010167 Ga0123353_10206687 Ga0123353_102066872 224
54 3300010167 Ga0123353_10216990 Ga0123353_102169903 224
55 3300010167 Ga0123353_10240731 Ga0123353_102407313 224
56 3300010167 Ga0123353_10245863 Ga0123353_102458633 224
57 3300010167 Ga0123353_10271502 Ga0123353_102715022 224
58 3300010167 Ga0123353_10292684 Ga0123353_102926843 224
59 3300010167 Ga0123353_10389318 Ga0123353_103893182 224
60 3300010167 Ga0123353_10436090 Ga0123353_104360902 224
61 3300010167 Ga0123353_10450073 Ga0123353_104500732 224
62 3300010167 Ga0123353_10464100 Ga0123353_104641001 224
63 3300010167 Ga0123353_10559460 Ga0123353_105594601 224
64 3300010167 Ga0123353_10562993 Ga0123353_105629931 224
65 3300010167 Ga0123353_10588504 Ga0123353_105885042 224
66 3300010167 Ga0123353_10647952 Ga0123353_106479522 224
67 3300010167 Ga0123353_10736056 Ga0123353_107360561 224
68 3300010167 Ga0123353_10762015 Ga0123353_107620151 224
69 3300010167 Ga0123353_10792026 Ga0123353_107920261 224
70 3300010167 Ga0123353_10803201 Ga0123353_108032012 224
71 3300010167 Ga0123353_10819287 Ga0123353_108192872 224
72 3300010167 Ga0123353_10853593 Ga0123353_108535931 224
73 3300010167 Ga0123353_10929951 Ga0123353_109299511 224
74 3300010167 Ga0123353_11033792 Ga0123353_110337922 224
75 3300010167 Ga0123353_11112776 Ga0123353_111127762 224
76 3300010167 Ga0123353_11121884 Ga0123353_111218842 224
77 3300010167 Ga0123353_11189516 Ga0123353_111895161 224
78 3300010167 Ga0123353_11642317 Ga0123353_116423171 224
79 3300010882 Ga0123354_10043917 Ga0123354_100439174 224
80 3300010882 Ga0123354_10064011 Ga0123354_100640117 224
81 3300010882 Ga0123354_10309238 Ga0123354_103092382 224
82 3300010882 Ga0123354_10342358 Ga0123354_103423581 224
83 3300010882 Ga0123354_10421474 Ga0123354_104214742 224
84 3300010882 Ga0123354_10445166 Ga0123354_104451661 224
85 3300042593 Ga0466691_069176 Ga0466691_069176_7004_7678 224
86 3300042593 Ga0466691_119497 Ga0466691_119497_725_1399 224
87 3300042596 Ga0466696_057995 Ga0466696_057995_2283_2957 224
88 3300042596 Ga0466696_144158 Ga0466696_144158_2213_2887 224
89 3300042596 Ga0466696_230413 Ga0466696_230413_4539_5213 224
90 3300042596 Ga0466696_267156 Ga0466696_267156_358_1032 224
91 3300042596 Ga0466696_450971 Ga0466696_450971_1295_1969 224
92 3300042596 Ga0466696_456435 Ga0466696_456435_138_812 224
93 3300042596 Ga0466696_494836 Ga0466696_494836_713_1387 224
94 3300042604 Ga0466717_068222 Ga0466717_068222_799_1473 224
95 3300042609 Ga0466722_203851 Ga0466722_203851_9768_10442 224
96 3300042612 Ga0466705_207009 Ga0466705_207009_30_704 224
97 3300042615 Ga0466711_255836 Ga0466711_255836_13_687 224
98 3300042616 Ga0466715_428383 Ga0466715_428383_26377_27051 224
99 3300042617 Ga0466718_133288 Ga0466718_133288_2133_2807 224
100 3300042618 Ga0466723_283907 Ga0466723_283907_2186_2860 224
101 3300042621 Ga0466729_204461 Ga0466729_204461_169_843 224
102 3300042621 Ga0466729_267814 Ga0466729_267814_6227_6901 224
103 3300042636 Ga0466703_027901 Ga0466703_027901_716_1390 224
104 3300042636 Ga0466703_084662 Ga0466703_084662_372_1046 224
105 3300042636 Ga0466703_124176 Ga0466703_124176_176_850 224
106 3300042636 Ga0466703_351065 Ga0466703_351065_3194_3868 224
107 3300042643 Ga0466704_032220 Ga0466704_032220_248_922 224
108 3300042648 Ga0466709_288539 Ga0466709_288539_1579_2253 224
109 3300010167 Ga0123353_10143515 Ga0123353_101435152 225
110 3300042602 Ga0466713_092105 Ga0466713_092105_2014_2691 225
111 3300010167 Ga0123353_10173383 Ga0123353_101733833 226
112 3300010167 Ga0123353_10730562 Ga0123353_107305622 226
113 3300042593 Ga0466691_197357 Ga0466691_197357_2897_3577 226
114 3300042601 Ga0466707_179582 Ga0466707_179582_513_1193 226
115 3300042620 Ga0466728_262078 Ga0466728_262078_1774_2454 226
116 iso_pr_bacteria 2873632256 2873633352 226
117 iso_pr_bacteria 2529293168 2531452247 228
118 3300042592 Ga0466693_065450 Ga0466693_065450_7199_7888 229
119 3300042643 Ga0466704_422929 Ga0466704_422929_1174_1863 229
120 3300000036 IMNBGM34_c009385 IMNBGM34_0093852 230
121 3300010167 Ga0123353_10144811 Ga0123353_101448115 230
122 3300010167 Ga0123353_10336400 Ga0123353_103364002 230
123 3300010167 Ga0123353_10472511 Ga0123353_104725112 230
124 3300010167 Ga0123353_10889774 Ga0123353_108897741 230
125 3300010167 Ga0123353_11196058 Ga0123353_111960581 230
126 3300010167 Ga0123353_11313860 Ga0123353_113138602 230
127 3300010167 Ga0123353_11483688 Ga0123353_114836881 230
128 3300010882 Ga0123354_10252298 Ga0123354_102522982 230
129 3300010882 Ga0123354_10570490 Ga0123354_105704902 230
130 3300010167 Ga0123353_10442761 Ga0123353_104427612 231
131 3300010167 Ga0123353_10613687 Ga0123353_106136872 231
132 3300010167 Ga0123353_10255712 Ga0123353_102557122 232
133 3300010167 Ga0123353_10255336 Ga0123353_102553362 233
134 3300010882 Ga0123354_10251052 Ga0123354_102510522 233
135 3300010167 Ga0123353_10580257 Ga0123353_105802572 234
136 3300042652 Ga0466708_007473 Ga0466708_007473_213_920 235
137 3300010167 Ga0123353_10444222 Ga0123353_104442221 236
138 3300042654 Ga0466725_385498 Ga0466725_385498_248_961 237
139 3300010167 Ga0123353_10185359 Ga0123353_101853594 239
140 3300010167 Ga0123353_10677498 Ga0123353_106774981 243
141 3300010167 Ga0123353_10068826 Ga0123353_100688263 244
142 3300010167 Ga0123353_10438363 Ga0123353_104383632 244
143 3300010167 Ga0123353_10623699 Ga0123353_106236992 244
144 3300042591 Ga0466692_183549 Ga0466692_183549_131_868 245
145 3300010167 Ga0123353_10568987 Ga0123353_105689871 260

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00072 Response_reg Response regulator receiver domain 14 124 0.99
PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal 156 231 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00072 GO:0000160 phosphorelay signal transduction system BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.58 0.6 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.