Protein Family IF09686

Metagenome Isolate
114 Members
29 Samples
111 Scaffolds
614.64 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_413399|Ga0466709_413399_415_2340
Length
641 aa
Sequence
LSSLEKEKERYMGKTIRLTMAQALVRFLDNQYIEADGEEIKFVTGVFGIFGHGVVVGLGEALAAGDHGLRFYQAKNEQGGAHAAMGYAKQQNRRRMMAVTSSIGPGALNMVTAAGTASVNRIPVLFLPGDVFACRQPDPVLQQVEIPQDYTNTASDAFRAVSRYWDRVNRPEQLMSAMINAFRVLTDPADTGAVTIALPQDVQGEAYDYPIEFFAKRVHHIERRIPTGGQIARAAAMIRAAKKPLVICGGGVRFSGAGEALAAFCETFRIPFGETQAGKGVIPWDNPCNLSGIGSTGSLAANRIAREADLIIAAGTRLGDFTTCSKWLFQNPGARILGINVASFDACKMNGEPIVADAKLTLEALTAVLSAEPPVYKSAWGERIEELRAEWKAEVDRLYSEELPPAPDGSPLLSQVRVLGELNERLLPRDAIVVSGSGSIPSDMQRVWRTRTPGTYHMEYGFSCMGYEIAAALGVKIGCPDREVAAIVGDGAYTMLHTELLTAVQEGKKIIVIVLDNAGFHCIDNLQRSQGIHKFGNEWNRRDEESGRLEGRAVRVDYAKNAESWGALGLRAETPEELRQAAAAALAAPGPVVIDVKVSPDSMTKGYDSWWRVGTAQVSANPEVVKAAEAMAAELARARQF

📊 Sample Types

Isolate 2.6%
Metagenome 97.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 48.3%
Termitidae 13.8%
Unclassified 13.8%
Rhinotermitidae 10.3%
Termopsidae 10.3%
Blaberidae 3.4%

🌳 Taxonomy

Archaea 0
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
2 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
3 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 2772190975 Treponema sp. RmG30 Isolate Blaberidae
14 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
15 650716102 Treponema primitia ZAS-2 Isolate Unclassified
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_145007 3300042615 Bacteria 4414
2 Ga0466715_106713 3300042616 Bacteria 2583
3 Ga0466715_445420 3300042616 Bacteria 16343
4 Ga0466723_007309 3300042618 Bacteria 5359
5 Ga0466723_024654 3300042618 Bacteria 62216
6 Ga0466726_108273 3300042619 Bacteria 13843
7 Ga0466726_491473 3300042619 Bacteria 1766
8 Ga0466719_028049 3300042606 Bacteria 40680
9 Ga0466722_186664 3300042609 Bacteria 6448
10 Ga0466691_117719 3300042593 Bacteria 7867
11 Ga0466696_456845 3300042596 Bacteria 4224
12 Ga0466703_065218 3300042636 Bacteria 7982
13 Ga0466704_086639 3300042643 Bacteria 26667
14 Ga0466704_111402 3300042643 Bacteria 4513
15 Ga0466704_235144 3300042643 Bacteria 29659
16 Ga0466709_064232 3300042648 Bacteria 10094
17 Ga0466709_376275 3300042648 Bacteria 10366
18 Ga0466705_029748 3300042612 Bacteria 29924
19 Ga0466711_407108 3300042615 Bacteria 25352
20 Ga0466723_345586 3300042618 Bacteria 28546
21 Ga0466728_100155 3300042620 Bacteria 13880
22 Ga0466728_188247 3300042620 Bacteria 7163
23 Ga0466690_412882 3300042590 Bacteria 2129
24 Ga0466692_077672 3300042591 Bacteria 18482
25 Ga0466696_183466 3300042596 Bacteria 2422
26 Ga0466704_395306 3300042643 Bacteria 11867
27 Ga0466709_413399 3300042648 Bacteria 2504
28 Ga0466708_217021 3300042652 Bacteria 11084
29 Ga0466708_367899 3300042652 Bacteria 11069
30 Ga0466705_076829 3300042612 Bacteria 7799
31 Ga0123353_10065748 3300010167 Bacteria 5821
32 Ga0466715_121745 3300042616 Bacteria 9708
33 Ga0466723_071185 3300042618 Bacteria 53854
34 Ga0466723_102684 3300042618 Bacteria 1669
35 Ga0466716_309999 3300042605 Bacteria 8808
36 Ga0466719_337836 3300042606 Unclassified 2894
37 Ga0466722_101044 3300042609 Bacteria 26620
38 Ga0466692_097992 3300042591 Bacteria 1921
39 Ga0466692_125830 3300042591 Bacteria 7652
40 Ga0466703_056878 3300042636 Bacteria 11031
41 Ga0466704_218273 3300042643 Bacteria 27455
42 Ga0466704_508064 3300042643 Bacteria 7280
43 Ga0466708_071796 3300042652 Bacteria 29991
44 Ga0466705_062309 3300042612 Bacteria 6400
45 Ga0466705_399756 3300042612 Bacteria 6728
46 Ga0466711_275454 3300042615 Bacteria 22441
47 Ga0466723_002099 3300042618 Bacteria 11340
48 Ga0466723_033439 3300042618 Bacteria 9848
49 Ga0466726_159582 3300042619 Bacteria 14093
50 Ga0466728_236150 3300042620 Bacteria 8347
51 Ga0466713_144521 3300042602 Bacteria 6195
52 Ga0466722_120145 3300042609 Bacteria 4948
53 Ga0466692_028197 3300042591 Bacteria 36639
54 Ga0466691_061523 3300042593 Bacteria 5371
55 Ga0466709_230844 3300042648 Bacteria 8587
56 Ga0466727_041651 3300042655 Bacteria 4873
57 Ga0466732_406953 3300042656 Bacteria 2682
58 Ga0466711_111716 3300042615 Bacteria 24512
59 Ga0466711_157042 3300042615 Bacteria 13212
60 Ga0466711_293849 3300042615 Bacteria 25662
61 Ga0466715_015885 3300042616 Bacteria 12645
62 Ga0466723_297302 3300042618 Bacteria 1926
63 Ga0466726_034143 3300042619 Bacteria 45757
64 Ga0466728_238987 3300042620 Bacteria 3633
65 Ga0466690_181360 3300042590 Bacteria 5875
66 Ga0466703_130402 3300042636 Bacteria 8224
67 Ga0466703_258371 3300042636 Bacteria 7853
68 Ga0466709_305197 3300042648 Bacteria 10392
69 Ga0466709_386244 3300042648 Bacteria 35005
70 Ga0123356_10070517 3300010049 Bacteria 3278
71 Ga0466705_451082 3300042612 Bacteria 13208
72 Ga0466711_167123 3300042615 Bacteria 17216
73 Ga0466715_014306 3300042616 Bacteria 17032
74 Ga0466723_265313 3300042618 Bacteria 10361
75 Ga0466728_338401 3300042620 Bacteria 5902
76 Ga0466713_064366 3300042602 Bacteria 3405
77 Ga0456237_0002790 3300041968 Bacteria 2828
78 Ga0466692_196387 3300042591 Bacteria 11129
79 Ga0466694_046539 3300042594 Bacteria 3820
80 Ga0466696_069087 3300042596 Bacteria 25119
81 Ga0466696_466578 3300042596 Bacteria 4837
82 Ga0466703_292827 3300042636 Bacteria 2867
83 Ga0466711_344932 3300042615 Bacteria 3773
84 Ga0466715_209207 3300042616 Bacteria 7550
85 Ga0466726_417794 3300042619 Bacteria 15594
86 Ga0466716_205626 3300042605 Bacteria 5746
87 Ga0466719_065600 3300042606 Bacteria 2869
88 Ga0466722_138276 3300042609 Bacteria 8457
89 Ga0466691_110483 3300042593 Bacteria 9774
90 Ga0466696_112350 3300042596 Bacteria 9006
91 Ga0466703_025134 3300042636 Bacteria 9771
92 Ga0466703_092831 3300042636 Bacteria 29083
93 Ga0466704_165838 3300042643 Bacteria 4721
94 Ga0466708_049912 3300042652 Bacteria 10244
95 Ga0466705_360862 3300042612 Bacteria 6529
96 Ga0123353_10367222 3300010167 Bacteria 2159
97 Ga0466715_127815 3300042616 Bacteria 21986
98 Ga0466715_145706 3300042616 Bacteria 4958
99 Ga0466726_012027 3300042619 Bacteria 8992
100 Ga0466728_075597 3300042620 Bacteria 10227
101 Ga0466707_200475 3300042601 Bacteria 1707
102 Ga0466716_074438 3300042605 Bacteria 33435
103 Ga0466719_138171 3300042606 Bacteria 15082
104 Ga0466690_002266 3300042590 Bacteria 8722
105 Ga0466690_320527 3300042590 Bacteria 5497
106 Ga0466691_040073 3300042593 Bacteria 10793
107 Ga0466696_418265 3300042596 Bacteria 3854
108 Ga0466735_003452 3300042624 Bacteria 7499
109 Ga0466735_091913 3300042624 Bacteria 3762
110 Ga0466709_130934 3300042648 Bacteria 9596
111 Ga0466708_100581 3300042652 Bacteria 3391

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 231 365 0.96
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 437 596 0.94
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 43 137 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02776 GO:0030976 thiamine pyrophosphate binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.