Protein Family IF09663
Metagenome
Isolate
120
Members
52
Samples
116
Scaffolds
126.5
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_330999|Ga0466709_330999_1556_1975
- Length
- 139 aa
- Sequence
- MYDRTIILESLQNIERVLQEVIEWTTHVRSSDDFTASTEGIILLNAVCMRLFVVGEELKATDKRTDKKLLPLYPGVDWRRAMKMRDIIGHHYFEINADVIYDTLRDDIPPLLEIIREIKTDIGEKAMGYWFFAALNSNL
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.0%
Kalotermitidae
20.0%
Unclassified
12.0%
Termopsidae
6.0%
Rhinotermitidae
4.0%
Hodotermitidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
0
Bacteria
105
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 3 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 4 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 5 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 6 | 2820714932 | Unclassified Fibrobacteres Nc150P4bin10 | Isolate | Unclassified |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 15 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 32 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 35 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 44 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 47 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 51 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10351584 | 3300010049 | Bacteria | 1597 |
| 2 | Ga0123353_10100578 | 3300010167 | Bacteria | 4660 |
| 3 | Ga0123353_10638586 | 3300010167 | Unclassified | 1510 |
| 4 | Ga0123354_10185389 | 3300010882 | Unclassified | 2356 |
| 5 | Ga0123354_10241414 | 3300010882 | Bacteria | 1857 |
| 6 | Ga0123354_10469320 | 3300010882 | Bacteria | 1004 |
| 7 | Ga0264413_105483 | 3300024493 | Bacteria | 1726 |
| 8 | Ga0415639_013563 | 3300038395 | Bacteria | 2066 |
| 9 | Ga0466693_058835 | 3300042592 | Bacteria | 1328 |
| 10 | Ga0466710_373712 | 3300042613 | Bacteria | 1035 |
| 11 | Ga0466712_087871 | 3300042614 | Unclassified | 6783 |
| 12 | Ga0466715_113331 | 3300042616 | Bacteria | 3675 |
| 13 | JGI24695J34938_10043557 | 3300002450 | Bacteria | 2001 |
| 14 | JGI24696J40584_12426306 | 3300002834 | Bacteria | 565 |
| 15 | Ga0068305_10084712 | 3300005083 | Bacteria | 12645 |
| 16 | Ga0466714_004323 | 3300042603 | Bacteria | 16717 |
| 17 | Ga0466719_137171 | 3300042606 | Bacteria | 1410 |
| 18 | Ga0466727_052249 | 3300042655 | Bacteria | 1115 |
| 19 | Ga0123356_12773652 | 3300010049 | Bacteria | 613 |
| 20 | Ga0123353_10217788 | 3300010167 | Bacteria | 2989 |
| 21 | Ga0123353_10387219 | 3300010167 | Bacteria | 2088 |
| 22 | Ga0123353_10418143 | 3300010167 | Unclassified | 1987 |
| 23 | Ga0466691_129426 | 3300042593 | Bacteria | 3649 |
| 24 | Ga0466694_152936 | 3300042594 | Bacteria | 2024 |
| 25 | Ga0466710_431209 | 3300042613 | Bacteria | 2349 |
| 26 | 2227471854 | 2225789004 | Bacteria | 23289 |
| 27 | Ga0072941_1048983 | 3300005201 | Bacteria | 1170 |
| 28 | Ga0466706_034239 | 3300042599 | Bacteria | 1049 |
| 29 | Ga0466714_061923 | 3300042603 | Bacteria | 2577 |
| 30 | Ga0466714_158208 | 3300042603 | Bacteria | 17679 |
| 31 | Ga0466717_077948 | 3300042604 | Unclassified | 1247 |
| 32 | Ga0466703_133600 | 3300042636 | Bacteria | 1172 |
| 33 | Ga0466697_219538 | 3300042611 | Unclassified | 1950 |
| 34 | Ga0123356_10048353 | 3300010049 | Bacteria | 3959 |
| 35 | Ga0123354_10498261 | 3300010882 | Unclassified | 951 |
| 36 | Ga0415639_018255 | 3300038395 | Unclassified | 1369 |
| 37 | Ga0466693_271161 | 3300042592 | Bacteria | 1045 |
| 38 | 2230930003 | 2228664001 | Bacteria | 5303 |
| 39 | Ga0072941_1048982 | 3300005201 | Bacteria | 1815 |
| 40 | Ga0466700_322401 | 3300042600 | Bacteria | 81969 |
| 41 | Ga0466714_131269 | 3300042603 | Bacteria | 4712 |
| 42 | Ga0466719_064944 | 3300042606 | Bacteria | 1227 |
| 43 | Ga0466731_225650 | 3300042622 | Bacteria | 2032 |
| 44 | Ga0123357_10210267 | 3300009784 | Bacteria | 2187 |
| 45 | Ga0123357_10489084 | 3300009784 | Bacteria | 1032 |
| 46 | Ga0123353_10952459 | 3300010167 | Bacteria | 1161 |
| 47 | Ga0123353_11904654 | 3300010167 | Bacteria | 733 |
| 48 | Ga0123354_10134883 | 3300010882 | Unclassified | 3093 |
| 49 | Ga0264413_130148 | 3300024493 | Bacteria | 1067 |
| 50 | Ga0415639_090910 | 3300038395 | Bacteria | 1377 |
| 51 | Ga0466712_037983 | 3300042614 | Bacteria | 12191 |
| 52 | Ga0466723_032522 | 3300042618 | Bacteria | 1183 |
| 53 | JGI24702J35022_10112813 | 3300002462 | Bacteria | 1496 |
| 54 | JGI24696J40584_12751883 | 3300002834 | Bacteria | 795 |
| 55 | Ga0072940_1025771 | 3300005200 | Unclassified | 3484 |
| 56 | Ga0072941_1172897 | 3300005201 | Bacteria | 2761 |
| 57 | Ga0466707_113152 | 3300042601 | Bacteria | 29051 |
| 58 | Ga0466714_030583 | 3300042603 | Bacteria | 3279 |
| 59 | Ga0466716_123397 | 3300042605 | Bacteria | 1159 |
| 60 | Ga0466731_270436 | 3300042622 | Bacteria | 11308 |
| 61 | Ga0466709_330999 | 3300042648 | Bacteria | 2449 |
| 62 | Ga0466724_11693 | 3300042649 | Bacteria | 3003 |
| 63 | Ga0123356_10063163 | 3300010049 | Bacteria | 3459 |
| 64 | Ga0123353_10727839 | 3300010167 | Bacteria | 1386 |
| 65 | Ga0123354_10614949 | 3300010882 | Bacteria | 790 |
| 66 | Ga0264413_116507 | 3300024493 | Unclassified | 1262 |
| 67 | Ga0466718_063714 | 3300042617 | Bacteria | 2954 |
| 68 | Ga0466728_158380 | 3300042620 | Bacteria | 1043 |
| 69 | AustNasuHG_c1037941 | 3300000089 | Unclassified | 1221 |
| 70 | JGI24702J35022_10136256 | 3300002462 | Bacteria | 1367 |
| 71 | Ga0072940_1108257 | 3300005200 | Bacteria | 693 |
| 72 | Ga0466701_052213 | 3300042598 | Bacteria | 2885 |
| 73 | Ga0466706_225176 | 3300042599 | Bacteria | 38857 |
| 74 | Ga0466706_236880 | 3300042599 | Bacteria | 1036 |
| 75 | Ga0466714_163465 | 3300042603 | Bacteria | 8768 |
| 76 | Ga0466719_514713 | 3300042606 | Bacteria | 1358 |
| 77 | Ga0466709_138086 | 3300042648 | Bacteria | 1146 |
| 78 | Ga0466697_156652 | 3300042611 | Bacteria | 2506 |
| 79 | Ga0123353_11186200 | 3300010167 | Bacteria | 1003 |
| 80 | Ga0466691_042219 | 3300042593 | Bacteria | 2260 |
| 81 | Ga0466712_155140 | 3300042614 | Bacteria | 1219 |
| 82 | Ga0466729_010629 | 3300042621 | Bacteria | 1001 |
| 83 | JGI24705J35276_11988005 | 3300002504 | Bacteria | 833 |
| 84 | JGI24705J35276_12221324 | 3300002504 | Bacteria | 2332 |
| 85 | Ga0466707_001024 | 3300042601 | Bacteria | 2279 |
| 86 | Ga0466735_234558 | 3300042624 | Bacteria | 1875 |
| 87 | Ga0466733_148351 | 3300042659 | Bacteria | 1689 |
| 88 | Ga0123356_10100212 | 3300010049 | Unclassified | 2778 |
| 89 | Ga0123354_10754889 | 3300010882 | Bacteria | 665 |
| 90 | Ga0264413_114162 | 3300024493 | Bacteria | 6385 |
| 91 | Ga0466694_266366 | 3300042594 | Bacteria | 1138 |
| 92 | Ga0466699_151037 | 3300042597 | Bacteria | 3453 |
| 93 | Ga0466718_135914 | 3300042617 | Bacteria | 1066 |
| 94 | Ga0466726_351459 | 3300042619 | Bacteria | 4840 |
| 95 | JGI24699J35502_10382843 | 3300002509 | Bacteria | 555 |
| 96 | JGI24699J35502_11134000 | 3300002509 | Bacteria | 23716 |
| 97 | Ga0068305_10203407 | 3300005083 | Bacteria | 1101 |
| 98 | Ga0072940_1048886 | 3300005200 | Bacteria | 871 |
| 99 | Ga0072940_1074458 | 3300005200 | Bacteria | 2641 |
| 100 | Ga0072940_1249992 | 3300005200 | Bacteria | 980 |
| 101 | Ga0466713_008221 | 3300042602 | Bacteria | 3618 |
| 102 | Ga0466714_127268 | 3300042603 | Bacteria | 1630 |
| 103 | Ga0466719_288945 | 3300042606 | Bacteria | 2418 |
| 104 | Ga0466722_202951 | 3300042609 | Bacteria | 7360 |
| 105 | Ga0466703_102985 | 3300042636 | Bacteria | 1156 |
| 106 | Ga0466708_219040 | 3300042652 | Bacteria | 23319 |
| 107 | Ga0466733_211327 | 3300042659 | Bacteria | 3875 |
| 108 | Ga0123353_10421730 | 3300010167 | Unclassified | 1977 |
| 109 | Ga0123353_10845282 | 3300010167 | Bacteria | 1256 |
| 110 | Ga0466718_008606 | 3300042617 | Bacteria | 2802 |
| 111 | AustNasuHG_c1008367 | 3300000089 | Unclassified | 3665 |
| 112 | JGI24705J35276_12189892 | 3300002504 | Bacteria | 1456 |
| 113 | Ga0466707_350785 | 3300042601 | Bacteria | 8507 |
| 114 | Ga0466735_154439 | 3300042624 | Bacteria | 1075 |
| 115 | Ga0466704_404643 | 3300042643 | Bacteria | 4307 |
| 116 | Ga0466727_154170 | 3300042655 | Bacteria | 16864 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042604 | Ga0466717_077948 | Ga0466717_077948_540_896 | 118 |
| 2 | 3300002504 | JGI24705J35276_11988005 | JGI24705J35276_119880052 | 119 |
| 3 | 3300042614 | Ga0466712_087871 | Ga0466712_087871_3998_4357 | 119 |
| 4 | 3300042603 | Ga0466714_030583 | Ga0466714_030583_425_787 | 120 |
| 5 | 3300042599 | Ga0466706_225176 | Ga0466706_225176_19766_20134 | 122 |
| 6 | 3300042599 | Ga0466706_236880 | Ga0466706_236880_307_675 | 122 |
| 7 | 3300042603 | Ga0466714_127268 | Ga0466714_127268_496_864 | 122 |
| 8 | 3300042613 | Ga0466710_431209 | Ga0466710_431209_940_1308 | 122 |
| 9 | 3300042617 | Ga0466718_008606 | Ga0466718_008606_1616_1984 | 122 |
| 10 | 3300042649 | Ga0466724_11693 | Ga0466724_11693_739_1107 | 122 |
| 11 | 3300005201 | Ga0072941_1048982 | Ga0072941_10489823 | 123 |
| 12 | 3300009784 | Ga0123357_10210267 | Ga0123357_102102672 | 123 |
| 13 | 3300038395 | Ga0415639_018255 | Ga0415639_018255_802_1173 | 123 |
| 14 | 3300038395 | Ga0415639_090910 | Ga0415639_090910_830_1201 | 123 |
| 15 | 3300042594 | Ga0466694_152936 | Ga0466694_152936_1498_1869 | 123 |
| 16 | 3300042599 | Ga0466706_034239 | Ga0466706_034239_104_475 | 123 |
| 17 | 3300042602 | Ga0466713_008221 | Ga0466713_008221_1118_1489 | 123 |
| 18 | 3300042611 | Ga0466697_219538 | Ga0466697_219538_710_1081 | 123 |
| 19 | 3300042624 | Ga0466735_154439 | Ga0466735_154439_475_846 | 123 |
| 20 | 3300002504 | JGI24705J35276_12189892 | JGI24705J35276_121898923 | 124 |
| 21 | 3300005083 | Ga0068305_10203407 | Ga0068305_102034073 | 124 |
| 22 | 3300010167 | Ga0123353_10387219 | Ga0123353_103872192 | 124 |
| 23 | 3300010167 | Ga0123353_10421730 | Ga0123353_104217302 | 124 |
| 24 | 3300010167 | Ga0123353_10638586 | Ga0123353_106385861 | 124 |
| 25 | 3300010167 | Ga0123353_10845282 | Ga0123353_108452822 | 124 |
| 26 | 3300010167 | Ga0123353_10952459 | Ga0123353_109524593 | 124 |
| 27 | 3300010882 | Ga0123354_10185389 | Ga0123354_101853893 | 124 |
| 28 | 3300010882 | Ga0123354_10469320 | Ga0123354_104693202 | 124 |
| 29 | 3300010882 | Ga0123354_10498261 | Ga0123354_104982612 | 124 |
| 30 | 3300042600 | Ga0466700_322401 | Ga0466700_322401_61492_61866 | 124 |
| 31 | 3300042603 | Ga0466714_061923 | Ga0466714_061923_270_644 | 124 |
| 32 | 3300042603 | Ga0466714_131269 | Ga0466714_131269_2802_3176 | 124 |
| 33 | 3300042603 | Ga0466714_158208 | Ga0466714_158208_11242_11616 | 124 |
| 34 | 3300042603 | Ga0466714_163465 | Ga0466714_163465_1368_1742 | 124 |
| 35 | 3300042606 | Ga0466719_064944 | Ga0466719_064944_286_660 | 124 |
| 36 | 3300042606 | Ga0466719_288945 | Ga0466719_288945_861_1235 | 124 |
| 37 | 3300042606 | Ga0466719_514713 | Ga0466719_514713_869_1243 | 124 |
| 38 | 3300042618 | Ga0466723_032522 | Ga0466723_032522_324_698 | 124 |
| 39 | 3300042620 | Ga0466728_158380 | Ga0466728_158380_345_719 | 124 |
| 40 | 3300042621 | Ga0466729_010629 | Ga0466729_010629_192_566 | 124 |
| 41 | 3300042643 | Ga0466704_404643 | Ga0466704_404643_3839_4213 | 124 |
| 42 | 3300042659 | Ga0466733_148351 | Ga0466733_148351_190_564 | 124 |
| 43 | 3300042659 | Ga0466733_211327 | Ga0466733_211327_3273_3647 | 124 |
| 44 | iso_pr_bacteria | 2820759988 | 2820761397 | 124 |
| 45 | iso_pr_bacteria | 2967483437 | 2967484689 | 124 |
| 46 | 2225789004 | 2227471854 | 2227918773 | 125 |
| 47 | 3300002504 | JGI24705J35276_12221324 | JGI24705J35276_122213243 | 125 |
| 48 | 3300002509 | JGI24699J35502_11134000 | JGI24699J35502_1113400017 | 125 |
| 49 | 3300002834 | JGI24696J40584_12426306 | JGI24696J40584_124263061 | 125 |
| 50 | 3300009784 | Ga0123357_10489084 | Ga0123357_104890843 | 125 |
| 51 | 3300042592 | Ga0466693_271161 | Ga0466693_271161_371_748 | 125 |
| 52 | 3300042614 | Ga0466712_155140 | Ga0466712_155140_731_1108 | 125 |
| 53 | 3300042617 | Ga0466718_135914 | Ga0466718_135914_572_949 | 125 |
| 54 | 3300042624 | Ga0466735_234558 | Ga0466735_234558_488_865 | 125 |
| 55 | 3300042636 | Ga0466703_133600 | Ga0466703_133600_567_944 | 125 |
| 56 | 3300005083 | Ga0068305_10084712 | Ga0068305_100847128 | 126 |
| 57 | 3300005200 | Ga0072940_1048886 | Ga0072940_10488862 | 126 |
| 58 | 3300005201 | Ga0072941_1048983 | Ga0072941_10489832 | 126 |
| 59 | 3300010167 | Ga0123353_10100578 | Ga0123353_101005783 | 126 |
| 60 | 3300010167 | Ga0123353_10418143 | Ga0123353_104181433 | 126 |
| 61 | 3300010882 | Ga0123354_10241414 | Ga0123354_102414144 | 126 |
| 62 | 3300024493 | Ga0264413_116507 | Ga0264413_1165072 | 126 |
| 63 | 3300042597 | Ga0466699_151037 | Ga0466699_151037_1499_1879 | 126 |
| 64 | 3300042601 | Ga0466707_001024 | Ga0466707_001024_1742_2122 | 126 |
| 65 | 3300042601 | Ga0466707_113152 | Ga0466707_113152_4262_4642 | 126 |
| 66 | 3300042605 | Ga0466716_123397 | Ga0466716_123397_680_1060 | 126 |
| 67 | 3300042609 | Ga0466722_202951 | Ga0466722_202951_5618_5998 | 126 |
| 68 | 3300042613 | Ga0466710_373712 | Ga0466710_373712_449_829 | 126 |
| 69 | 3300042614 | Ga0466712_037983 | Ga0466712_037983_5977_6357 | 126 |
| 70 | 3300042617 | Ga0466718_063714 | Ga0466718_063714_52_432 | 126 |
| 71 | 3300042636 | Ga0466703_102985 | Ga0466703_102985_704_1084 | 126 |
| 72 | 2228664001 | 2230930003 | 2230625708 | 127 |
| 73 | 3300002462 | JGI24702J35022_10112813 | JGI24702J35022_101128132 | 127 |
| 74 | 3300002462 | JGI24702J35022_10136256 | JGI24702J35022_101362561 | 127 |
| 75 | 3300042598 | Ga0466701_052213 | Ga0466701_052213_1131_1514 | 127 |
| 76 | 3300042598 | Ga0466701_052213 | Ga0466701_052213_1826_2209 | 127 |
| 77 | 3300042606 | Ga0466719_137171 | Ga0466719_137171_549_932 | 127 |
| 78 | 3300042622 | Ga0466731_225650 | Ga0466731_225650_1573_1956 | 127 |
| 79 | 3300042622 | Ga0466731_270436 | Ga0466731_270436_2067_2450 | 127 |
| 80 | iso_pr_bacteria | 2820714932 | 2820715620 | 127 |
| 81 | 3300000089 | AustNasuHG_c1008367 | AustNasuHG_10083672 | 128 |
| 82 | 3300000089 | AustNasuHG_c1037941 | AustNasuHG_10379412 | 128 |
| 83 | 3300002834 | JGI24696J40584_12751883 | JGI24696J40584_127518831 | 128 |
| 84 | 3300005200 | Ga0072940_1025771 | Ga0072940_10257711 | 128 |
| 85 | 3300005201 | Ga0072941_1172897 | Ga0072941_11728973 | 128 |
| 86 | 3300010167 | Ga0123353_11186200 | Ga0123353_111862003 | 128 |
| 87 | 3300010882 | Ga0123354_10614949 | Ga0123354_106149492 | 128 |
| 88 | 3300038395 | Ga0415639_013563 | Ga0415639_013563_1467_1853 | 128 |
| 89 | 3300002450 | JGI24695J34938_10043557 | JGI24695J34938_100435574 | 129 |
| 90 | 3300005200 | Ga0072940_1074458 | Ga0072940_10744583 | 129 |
| 91 | 3300005200 | Ga0072940_1249992 | Ga0072940_12499921 | 129 |
| 92 | 3300010049 | Ga0123356_10048353 | Ga0123356_100483534 | 129 |
| 93 | 3300010049 | Ga0123356_10100212 | Ga0123356_101002124 | 129 |
| 94 | 3300010049 | Ga0123356_10351584 | Ga0123356_103515842 | 129 |
| 95 | 3300010049 | Ga0123356_12773652 | Ga0123356_127736522 | 129 |
| 96 | 3300010167 | Ga0123353_10727839 | Ga0123353_107278391 | 129 |
| 97 | 3300010882 | Ga0123354_10134883 | Ga0123354_101348835 | 129 |
| 98 | 3300010882 | Ga0123354_10754889 | Ga0123354_107548891 | 129 |
| 99 | 3300024493 | Ga0264413_130148 | Ga0264413_1301481 | 129 |
| 100 | 3300042593 | Ga0466691_042219 | Ga0466691_042219_1267_1656 | 129 |
| 101 | 3300042616 | Ga0466715_113331 | Ga0466715_113331_1076_1465 | 129 |
| 102 | 3300042648 | Ga0466709_138086 | Ga0466709_138086_432_821 | 129 |
| 103 | 3300005200 | Ga0072940_1108257 | Ga0072940_11082572 | 130 |
| 104 | 3300010167 | Ga0123353_10217788 | Ga0123353_102177883 | 130 |
| 105 | 3300010167 | Ga0123353_11904654 | Ga0123353_119046542 | 130 |
| 106 | 3300042601 | Ga0466707_350785 | Ga0466707_350785_1951_2343 | 130 |
| 107 | 3300042603 | Ga0466714_004323 | Ga0466714_004323_5777_6169 | 130 |
| 108 | 3300042593 | Ga0466691_129426 | Ga0466691_129426_2922_3317 | 131 |
| 109 | 3300042594 | Ga0466694_266366 | Ga0466694_266366_56_451 | 131 |
| 110 | 3300042611 | Ga0466697_156652 | Ga0466697_156652_756_1151 | 131 |
| 111 | 3300042592 | Ga0466693_058835 | Ga0466693_058835_783_1181 | 132 |
| 112 | 3300042655 | Ga0466727_154170 | Ga0466727_154170_8136_8534 | 132 |
| 113 | 3300002509 | JGI24699J35502_10382843 | JGI24699J35502_103828431 | 133 |
| 114 | 3300024493 | Ga0264413_114162 | Ga0264413_1141623 | 134 |
| 115 | 3300024493 | Ga0264413_105483 | Ga0264413_1054832 | 135 |
| 116 | 3300042619 | Ga0466726_351459 | Ga0466726_351459_4288_4695 | 135 |
| 117 | 3300042655 | Ga0466727_052249 | Ga0466727_052249_581_991 | 136 |
| 118 | 3300042648 | Ga0466709_330999 | Ga0466709_330999_1556_1975 | 139 |
| 119 | 3300010049 | Ga0123356_10063163 | Ga0123356_100631631 | 140 |
| 120 | 3300042652 | Ga0466708_219040 | Ga0466708_219040_22041_22472 | 143 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01934 | HepT-like | Ribonuclease HepT-like | 18 | 118 | 0.82 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.83 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.