Protein Family IF09628
Metagenome
Isolate
121
Members
39
Samples
118
Scaffolds
384.52
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_220714|Ga0466709_220714_4227_5363
- Length
- 378 aa
- Sequence
- MQYVTYGKTGLKVSRLGLGCMRLPSYEKDGKTIFDEEKSISLIHRAMDLGVNYFDTAPGYCDTLSEIIVGKALKGGRREKIFLSTKNPIENDSGDDYEKRLEKSLKKLDTGYIDFYHFWGITLDTFVHKINVPDGPLSRAKKLKAQGVIRHISFSFHDTPGNMAEIVRRGEGEFSSLLCQYNLLDRSNARDIDFAYGEGLGIAVMGPVGGGRLGAPTKVIQDLLPGKVHSSAEVALRYVFSNPHIHIALSGMSSIEQLEENAAIVDNTAPLSPVEQERILAMMKENERLAGLYCTGCKYCMPCPQGLNIPELFTLMNYHRVYQITEFAQKTYAQIGKVPWMMYENAAACVECGVCEDKCPQKLPIRKQLKETHKTLAV
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.8%
Termitidae
34.2%
Unclassified
10.5%
Rhinotermitidae
7.9%
Termopsidae
7.9%
Hodotermitidae
2.6%
Taxonomy
Archaea
1
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 2 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 3 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_043020 | 3300042614 | Bacteria | 10399 |
| 2 | Ga0466712_058877 | 3300042614 | Bacteria | 25182 |
| 3 | Ga0466718_159659 | 3300042617 | Bacteria | 1846 |
| 4 | Ga0466726_089413 | 3300042619 | Bacteria | 5102 |
| 5 | Ga0466728_062850 | 3300042620 | Bacteria | 2619 |
| 6 | Ga0466691_132760 | 3300042593 | Bacteria | 3506 |
| 7 | Ga0466735_068378 | 3300042624 | Bacteria | 3392 |
| 8 | Ga0466703_255268 | 3300042636 | Bacteria | 2623 |
| 9 | Ga0466709_026631 | 3300042648 | Bacteria | 14426 |
| 10 | Ga0466727_101998 | 3300042655 | Bacteria | 5094 |
| 11 | AustNasuHG_c1006243 | 3300000089 | Bacteria | 4258 |
| 12 | Ga0072941_1019068 | 3300005201 | Bacteria | 5261 |
| 13 | Ga0466706_071759 | 3300042599 | Bacteria | 1372 |
| 14 | Ga0466719_194305 | 3300042606 | Bacteria | 4170 |
| 15 | Ga0466698_236113 | 3300042610 | Bacteria | 1386 |
| 16 | Ga0466705_043926 | 3300042612 | Bacteria | 3465 |
| 17 | Ga0123357_10100184 | 3300009784 | Bacteria | 3739 |
| 18 | Ga0466712_234671 | 3300042614 | Bacteria | 6701 |
| 19 | Ga0466711_175538 | 3300042615 | Bacteria | 43523 |
| 20 | Ga0466718_045216 | 3300042617 | Bacteria | 3629 |
| 21 | Ga0466694_246372 | 3300042594 | Bacteria | 2639 |
| 22 | Ga0466694_407720 | 3300042594 | Bacteria | 2855 |
| 23 | Ga0466699_103125 | 3300042597 | Bacteria | 4183 |
| 24 | Ga0466703_121472 | 3300042636 | Bacteria | 13448 |
| 25 | AustNasuHG_c1000580 | 3300000089 | Bacteria | 12907 |
| 26 | Ga0466707_163413 | 3300042601 | Bacteria | 4063 |
| 27 | Ga0466716_021020 | 3300042605 | Bacteria | 8650 |
| 28 | Ga0466720_030086 | 3300042607 | Bacteria | 1803 |
| 29 | Ga0466720_046925 | 3300042607 | Bacteria | 1358 |
| 30 | Ga0466722_159819 | 3300042609 | Bacteria | 3025 |
| 31 | Ga0466712_272471 | 3300042614 | Bacteria | 2924 |
| 32 | Ga0466715_349454 | 3300042616 | Bacteria | 41739 |
| 33 | Ga0466729_040049 | 3300042621 | Bacteria | 2307 |
| 34 | Ga0466696_028437 | 3300042596 | Bacteria | 47665 |
| 35 | Ga0466696_204250 | 3300042596 | Bacteria | 2889 |
| 36 | Ga0466699_043720 | 3300042597 | Bacteria | 24375 |
| 37 | Ga0466699_245580 | 3300042597 | Bacteria | 19984 |
| 38 | Ga0466699_412125 | 3300042597 | Unclassified | 2759 |
| 39 | Ga0466735_186691 | 3300042624 | Bacteria | 9243 |
| 40 | Ga0466703_030542 | 3300042636 | Unclassified | 2483 |
| 41 | Ga0466703_063524 | 3300042636 | Unclassified | 4435 |
| 42 | Ga0466709_220714 | 3300042648 | Bacteria | 12433 |
| 43 | Ga0466708_255900 | 3300042652 | Bacteria | 2367 |
| 44 | AustNasuHG_c1026487 | 3300000089 | Bacteria | 1805 |
| 45 | Ga0466707_066585 | 3300042601 | Unclassified | 1658 |
| 46 | Ga0466719_527305 | 3300042606 | Bacteria | 10995 |
| 47 | Ga0466712_028599 | 3300042614 | Bacteria | 26608 |
| 48 | Ga0466712_109596 | 3300042614 | Bacteria | 15349 |
| 49 | Ga0466718_098669 | 3300042617 | Bacteria | 1539 |
| 50 | Ga0466694_149503 | 3300042594 | Bacteria | 3151 |
| 51 | Ga0466696_348440 | 3300042596 | Bacteria | 5431 |
| 52 | Ga0466699_342016 | 3300042597 | Bacteria | 7753 |
| 53 | Ga0466709_223564 | 3300042648 | Bacteria | 6795 |
| 54 | Ga0466708_335657 | 3300042652 | Bacteria | 9039 |
| 55 | Ga0466727_202860 | 3300042655 | Bacteria | 4799 |
| 56 | JGI24698J34947_10030969 | 3300002449 | Bacteria | 2818 |
| 57 | Ga0466716_085974 | 3300042605 | Bacteria | 7895 |
| 58 | Ga0466732_081939 | 3300042656 | Bacteria | 3113 |
| 59 | Ga0123357_10023060 | 3300009784 | Bacteria | 8358 |
| 60 | Ga0466711_046725 | 3300042615 | Bacteria | 2231 |
| 61 | Ga0466715_009454 | 3300042616 | Bacteria | 11159 |
| 62 | Ga0466715_136346 | 3300042616 | Bacteria | 9194 |
| 63 | Ga0466723_050194 | 3300042618 | Bacteria | 9529 |
| 64 | Ga0466723_182417 | 3300042618 | Bacteria | 25448 |
| 65 | Ga0466726_206704 | 3300042619 | Bacteria | 1599 |
| 66 | Ga0466728_143134 | 3300042620 | Bacteria | 2348 |
| 67 | Ga0466703_089740 | 3300042636 | Bacteria | 13321 |
| 68 | Ga0466703_395171 | 3300042636 | Bacteria | 1436 |
| 69 | Ga0466727_348193 | 3300042655 | Bacteria | 2992 |
| 70 | JGI24698J34947_10001002 | 3300002449 | Bacteria | 14498 |
| 71 | JGI24698J34947_10006174 | 3300002449 | Unclassified | 6581 |
| 72 | Ga0466707_165173 | 3300042601 | Bacteria | 5150 |
| 73 | Ga0466719_036914 | 3300042606 | Bacteria | 9855 |
| 74 | Ga0466720_024432 | 3300042607 | Bacteria | 2159 |
| 75 | Ga0466705_146159 | 3300042612 | Bacteria | 5282 |
| 76 | Ga0466705_168737 | 3300042612 | Bacteria | 19471 |
| 77 | Ga0466715_155296 | 3300042616 | Bacteria | 5619 |
| 78 | Ga0466718_088176 | 3300042617 | Bacteria | 2043 |
| 79 | Ga0466690_339415 | 3300042590 | Bacteria | 9655 |
| 80 | Ga0466692_115587 | 3300042591 | Archaea | 1546 |
| 81 | Ga0466696_025993 | 3300042596 | Bacteria | 11411 |
| 82 | Ga0466699_230553 | 3300042597 | Bacteria | 2266 |
| 83 | Ga0466699_307206 | 3300042597 | Unclassified | 1654 |
| 84 | Ga0466703_292012 | 3300042636 | Bacteria | 42783 |
| 85 | Ga0466704_483469 | 3300042643 | Bacteria | 21202 |
| 86 | Ga0466704_557630 | 3300042643 | Bacteria | 4233 |
| 87 | Ga0466709_046489 | 3300042648 | Unclassified | 1450 |
| 88 | Ga0466727_125772 | 3300042655 | Unclassified | 1396 |
| 89 | JGI24698J34947_10008343 | 3300002449 | Bacteria | 5683 |
| 90 | JGI24698J34947_10015998 | 3300002449 | Bacteria | 4079 |
| 91 | Ga0072941_1001255 | 3300005201 | Bacteria | 90205 |
| 92 | Ga0466707_319505 | 3300042601 | Bacteria | 5778 |
| 93 | Ga0466722_022356 | 3300042609 | Bacteria | 2123 |
| 94 | Ga0466698_403122 | 3300042610 | Bacteria | 3040 |
| 95 | Ga0466732_420569 | 3300042656 | Bacteria | 3365 |
| 96 | Ga0123353_10715221 | 3300010167 | Bacteria | 1402 |
| 97 | Ga0466712_151289 | 3300042614 | Bacteria | 1368 |
| 98 | Ga0466691_209139 | 3300042593 | Bacteria | 9020 |
| 99 | Ga0466694_243559 | 3300042594 | Bacteria | 9213 |
| 100 | Ga0466708_015554 | 3300042652 | Bacteria | 30533 |
| 101 | Ga0466727_178593 | 3300042655 | Unclassified | 2399 |
| 102 | Ga0072941_1000141 | 3300005201 | Bacteria | 43983 |
| 103 | Ga0466700_067182 | 3300042600 | Bacteria | 1787 |
| 104 | Ga0466707_198888 | 3300042601 | Bacteria | 1321 |
| 105 | Ga0466707_344900 | 3300042601 | Unclassified | 1875 |
| 106 | Ga0466716_080780 | 3300042605 | Bacteria | 20496 |
| 107 | Ga0466722_169528 | 3300042609 | Bacteria | 1687 |
| 108 | Ga0466694_122253 | 3300042594 | Bacteria | 2939 |
| 109 | Ga0466699_230182 | 3300042597 | Bacteria | 6399 |
| 110 | Ga0466699_233055 | 3300042597 | Bacteria | 20555 |
| 111 | Ga0466699_439168 | 3300042597 | Unclassified | 4727 |
| 112 | Ga0466704_079313 | 3300042643 | Unclassified | 11972 |
| 113 | Ga0466704_225677 | 3300042643 | Bacteria | 2320 |
| 114 | Ga0466708_220002 | 3300042652 | Bacteria | 3896 |
| 115 | JGI24698J34947_10001268 | 3300002449 | Bacteria | 13219 |
| 116 | JGI24702J35022_10002110 | 3300002462 | Bacteria | 12275 |
| 117 | Ga0466719_061882 | 3300042606 | Unclassified | 5265 |
| 118 | Ga0466698_363232 | 3300042610 | Bacteria | 1563 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.