Protein Family IF09597
Metagenome
Isolate
103
Members
36
Samples
102
Scaffolds
179.15
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_118823|Ga0466709_118823_332_910
- Length
- 192 aa
- Sequence
- MVKKHSYISNAMSTPTSSMPENVRLVRLEENTVIPPFESEDKDLNDFLLNDAKNYLKSLLAITYMYQTDNETVAYFSLSNDSLIKRDDKQPIWNKINRAIPNDKRRRSYPAVKIGRLAVSKKYAGMGIGSRIILTIQNMYINEQQRAGCRFLTVDAYRNALPFYQKNSFKFLTEQDLSDDTRTLYFDLKALN
Sample Types
Isolate
1.0%
Metagenome
99.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.4%
Kalotermitidae
33.3%
Unclassified
11.1%
Rhinotermitidae
5.6%
Termopsidae
5.6%
Taxonomy
Archaea
1
Bacteria
99
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 7 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 8 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 13 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 14 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_293042 | 3300042612 | Bacteria | 3278 |
| 2 | Ga0466728_219524 | 3300042620 | Bacteria | 1380 |
| 3 | JGI24702J35022_10002553 | 3300002462 | Bacteria | 11077 |
| 4 | Ga0123357_10000256 | 3300009784 | Bacteria | 51026 |
| 5 | Ga0466694_264942 | 3300042594 | Bacteria | 1018 |
| 6 | Ga0466703_009210 | 3300042636 | Bacteria | 2686 |
| 7 | Ga0466709_138201 | 3300042648 | Bacteria | 1284 |
| 8 | Ga0466713_048621 | 3300042602 | Bacteria | 4688 |
| 9 | Ga0466719_534018 | 3300042606 | Bacteria | 1931 |
| 10 | Ga0123356_10702533 | 3300010049 | Bacteria | 1180 |
| 11 | JGI24702J35022_10082576 | 3300002462 | Bacteria | 1742 |
| 12 | Ga0466690_285662 | 3300042590 | Bacteria | 7150 |
| 13 | Ga0466690_292723 | 3300042590 | Bacteria | 6595 |
| 14 | Ga0466691_103945 | 3300042593 | Unclassified | 1154 |
| 15 | Ga0466734_009846 | 3300042623 | Bacteria | 1165 |
| 16 | Ga0466704_105009 | 3300042643 | Bacteria | 13569 |
| 17 | Ga0466708_267907 | 3300042652 | Bacteria | 4927 |
| 18 | Ga0123357_10146015 | 3300009784 | Bacteria | 2889 |
| 19 | Ga0123356_10399786 | 3300010049 | Unclassified | 1511 |
| 20 | Ga0123353_10473714 | 3300010167 | Bacteria | 1834 |
| 21 | Ga0123353_11018307 | 3300010167 | Bacteria | 1110 |
| 22 | Ga0466705_063853 | 3300042612 | Bacteria | 1911 |
| 23 | Ga0466705_221824 | 3300042612 | Bacteria | 1907 |
| 24 | Ga0466723_180035 | 3300042618 | Bacteria | 5097 |
| 25 | JGI24702J35022_10194215 | 3300002462 | Bacteria | 1159 |
| 26 | JGI24702J35022_10251310 | 3300002462 | Bacteria | 1029 |
| 27 | Ga0466690_206890 | 3300042590 | Bacteria | 5664 |
| 28 | Ga0466691_227165 | 3300042593 | Bacteria | 7427 |
| 29 | Ga0466735_222831 | 3300042624 | Bacteria | 1040 |
| 30 | Ga0466704_016556 | 3300042643 | Bacteria | 24571 |
| 31 | Ga0466704_156043 | 3300042643 | Bacteria | 1263 |
| 32 | Ga0466704_333409 | 3300042643 | Bacteria | 40479 |
| 33 | Ga0466709_118823 | 3300042648 | Bacteria | 1688 |
| 34 | Ga0466719_502204 | 3300042606 | Bacteria | 1205 |
| 35 | Ga0466722_221509 | 3300042609 | Bacteria | 30276 |
| 36 | Ga0123356_10699282 | 3300010049 | Bacteria | 1183 |
| 37 | Ga0466705_215138 | 3300042612 | Bacteria | 9511 |
| 38 | Ga0466723_135338 | 3300042618 | Bacteria | 28340 |
| 39 | Ga0466691_091076 | 3300042593 | Bacteria | 1668 |
| 40 | Ga0466691_102040 | 3300042593 | Bacteria | 39028 |
| 41 | Ga0466703_048306 | 3300042636 | Bacteria | 1784 |
| 42 | Ga0466703_237478 | 3300042636 | Bacteria | 1123 |
| 43 | Ga0466704_267635 | 3300042643 | Bacteria | 1654 |
| 44 | Ga0466724_39679 | 3300042649 | Bacteria | 2718 |
| 45 | Ga0466707_314228 | 3300042601 | Bacteria | 1084 |
| 46 | Ga0466719_455234 | 3300042606 | Bacteria | 1378 |
| 47 | Ga0123357_10235026 | 3300009784 | Bacteria | 1999 |
| 48 | Ga0466697_187282 | 3300042611 | Bacteria | 1379 |
| 49 | Ga0466705_487929 | 3300042612 | Bacteria | 1922 |
| 50 | Ga0466710_064789 | 3300042613 | Archaea | 1464 |
| 51 | Ga0466718_099815 | 3300042617 | Bacteria | 1064 |
| 52 | JGI24696J40584_12874921 | 3300002834 | Bacteria | 1060 |
| 53 | Ga0068305_10042248 | 3300005083 | Bacteria | 782 |
| 54 | Ga0466701_002523 | 3300042598 | Bacteria | 1156 |
| 55 | Ga0466703_158077 | 3300042636 | Bacteria | 1429 |
| 56 | Ga0466704_001795 | 3300042643 | Bacteria | 1654 |
| 57 | Ga0466719_458744 | 3300042606 | Bacteria | 3581 |
| 58 | Ga0466719_515102 | 3300042606 | Bacteria | 1081 |
| 59 | Ga0466721_185689 | 3300042608 | Bacteria | 1972 |
| 60 | Ga0466697_001784 | 3300042611 | Bacteria | 1150 |
| 61 | Ga0123357_10198203 | 3300009784 | Bacteria | 2293 |
| 62 | Ga0123353_10524650 | 3300010167 | Bacteria | 1717 |
| 63 | Ga0466697_095762 | 3300042611 | Bacteria | 3489 |
| 64 | Ga0466710_385161 | 3300042613 | Bacteria | 1189 |
| 65 | Ga0466715_136705 | 3300042616 | Bacteria | 3851 |
| 66 | Ga0466728_100856 | 3300042620 | Bacteria | 9839 |
| 67 | JGI24702J35022_10383604 | 3300002462 | Bacteria | 846 |
| 68 | JGI24696J40584_12903710 | 3300002834 | Bacteria | 1203 |
| 69 | Ga0466693_377050 | 3300042592 | Bacteria | 1604 |
| 70 | Ga0466704_149839 | 3300042643 | Bacteria | 9706 |
| 71 | Ga0466704_489281 | 3300042643 | Bacteria | 2195 |
| 72 | Ga0466725_106538 | 3300042654 | Bacteria | 1214 |
| 73 | Ga0466725_332846 | 3300042654 | Bacteria | 33341 |
| 74 | Ga0466707_251159 | 3300042601 | Bacteria | 5355 |
| 75 | Ga0466707_369762 | 3300042601 | Bacteria | 1960 |
| 76 | Ga0123357_10194653 | 3300009784 | Unclassified | 2326 |
| 77 | Ga0466697_235564 | 3300042611 | Bacteria | 2113 |
| 78 | Ga0466705_191440 | 3300042612 | Bacteria | 17766 |
| 79 | Ga0466728_299327 | 3300042620 | Bacteria | 10822 |
| 80 | Ga0466729_113095 | 3300042621 | Bacteria | 2780 |
| 81 | JGI24702J35022_10466193 | 3300002462 | Bacteria | 771 |
| 82 | Ga0466690_012376 | 3300042590 | Bacteria | 7094 |
| 83 | Ga0466703_030933 | 3300042636 | Bacteria | 1934 |
| 84 | Ga0466704_094066 | 3300042643 | Bacteria | 24442 |
| 85 | Ga0466708_099941 | 3300042652 | Bacteria | 55771 |
| 86 | Ga0466727_196046 | 3300042655 | Bacteria | 1242 |
| 87 | Ga0466713_149506 | 3300042602 | Bacteria | 2466 |
| 88 | Ga0466719_014031 | 3300042606 | Bacteria | 1816 |
| 89 | Ga0466719_451440 | 3300042606 | Bacteria | 6268 |
| 90 | Ga0466697_015073 | 3300042611 | Bacteria | 1911 |
| 91 | Ga0123353_11197310 | 3300010167 | Bacteria | 997 |
| 92 | Ga0123353_11483471 | 3300010167 | Bacteria | 865 |
| 93 | Ga0466697_173829 | 3300042611 | Bacteria | 3099 |
| 94 | Ga0466705_499365 | 3300042612 | Bacteria | 1003 |
| 95 | Ga0466656_353454 | 3300042550 | Bacteria | 1007 |
| 96 | Ga0466691_088769 | 3300042593 | Bacteria | 5436 |
| 97 | Ga0466703_138079 | 3300042636 | Bacteria | 2763 |
| 98 | Ga0466704_170058 | 3300042643 | Bacteria | 1389 |
| 99 | Ga0466704_294382 | 3300042643 | Bacteria | 1321 |
| 100 | Ga0466727_123703 | 3300042655 | Bacteria | 13736 |
| 101 | Ga0466716_104486 | 3300042605 | Bacteria | 1702 |
| 102 | Ga0466719_243078 | 3300042606 | Bacteria | 2653 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13673 | GO:0016747 | acyltransferase activity, transferring groups other than amino-acyl groups | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.