Protein Family IF09536
Metagenome
Isolate
122
Members
44
Samples
115
Scaffolds
269.7
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_540667|Ga0466704_540667_3734_4621
- Length
- 295 aa
- Sequence
- MPERPRLPTQMIYWKNMVDKQTQKTNFLKKRQYLKKIQSYNRLIDELLVKEEEILDTMKDDAGNYALERITLTEIMLNLASNYLVVNGVSQSILRIKNEDALNEGRKAVYKSVIYLEDTVSNFVDAAYSEYEEKLAGIEGLDAMRRYTLVRKMGLAIRLLEDAYGDNTKWKWSFVELEGRYAVVTKNLLDLKKAAASLDPHSPEYRPLTYHFRLSRRLLLQAADRYREKYELVTHNLDDFKTGILFLSALQRFLAQMGERSELEMVRKKYNIWIAKLETDSKTRIDLAIPKSTGF
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Kalotermitidae
31.0%
Unclassified
16.7%
Termopsidae
7.1%
Passalidae
2.4%
Taxonomy
Archaea
0
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 4 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 5 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 18 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 19 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 20 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 21 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 38 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10002720 | 3300010049 | Bacteria | 18801 |
| 2 | Ga0123356_10377308 | 3300010049 | Bacteria | 1550 |
| 3 | Ga0466731_065882 | 3300042622 | Bacteria | 5364 |
| 4 | Ga0466731_249476 | 3300042622 | Bacteria | 1539 |
| 5 | Ga0466704_540667 | 3300042643 | Bacteria | 25259 |
| 6 | Ga0264413_110063 | 3300024493 | Bacteria | 4183 |
| 7 | Ga0466718_077824 | 3300042617 | Bacteria | 37727 |
| 8 | Ga0466718_167124 | 3300042617 | Bacteria | 2023 |
| 9 | JGI24695J34938_10001376 | 3300002450 | Bacteria | 20894 |
| 10 | JGI24695J34938_10024727 | 3300002450 | Bacteria | 2881 |
| 11 | Ga0466719_490967 | 3300042606 | Bacteria | 2122 |
| 12 | Ga0466732_296830 | 3300042656 | Bacteria | 4423 |
| 13 | Ga0466731_354235 | 3300042622 | Bacteria | 1111 |
| 14 | Ga0466735_194186 | 3300042624 | Bacteria | 4538 |
| 15 | Ga0466703_375903 | 3300042636 | Bacteria | 1376 |
| 16 | Ga0466727_330944 | 3300042655 | Bacteria | 13899 |
| 17 | Ga0264413_110096 | 3300024493 | Bacteria | 3494 |
| 18 | Ga0466694_147668 | 3300042594 | Unclassified | 2034 |
| 19 | Ga0466712_014667 | 3300042614 | Bacteria | 27818 |
| 20 | Ga0466723_009536 | 3300042618 | Bacteria | 7102 |
| 21 | Ga0466726_212704 | 3300042619 | Bacteria | 14720 |
| 22 | AustNasuHG_c1018964 | 3300000089 | Bacteria | 2263 |
| 23 | Ga0072941_1124291 | 3300005201 | Bacteria | 1122 |
| 24 | Ga0074263_117787 | 3300005485 | Unclassified | 2684 |
| 25 | Ga0466716_110060 | 3300042605 | Bacteria | 12632 |
| 26 | Ga0123356_10000191 | 3300010049 | Bacteria | 70964 |
| 27 | Ga0123356_10002085 | 3300010049 | Bacteria | 21580 |
| 28 | Ga0123356_11059366 | 3300010049 | Bacteria | 980 |
| 29 | Ga0123353_10353293 | 3300010167 | Bacteria | 2213 |
| 30 | Ga0466704_245588 | 3300042643 | Bacteria | 25369 |
| 31 | Ga0264413_104723 | 3300024493 | Bacteria | 2343 |
| 32 | Ga0264413_120359 | 3300024493 | Unclassified | 6537 |
| 33 | Ga0466695_211384 | 3300042595 | Bacteria | 31275 |
| 34 | Ga0466715_617142 | 3300042616 | Unclassified | 2063 |
| 35 | Ga0466718_157887 | 3300042617 | Bacteria | 21556 |
| 36 | Ga0466728_022002 | 3300042620 | Bacteria | 10498 |
| 37 | JGI24698J34947_10095795 | 3300002449 | Bacteria | 1348 |
| 38 | JGI24695J34938_10048537 | 3300002450 | Bacteria | 1869 |
| 39 | Ga0072941_1007233 | 3300005201 | Unclassified | 40154 |
| 40 | Ga0072941_1042251 | 3300005201 | Bacteria | 3672 |
| 41 | Ga0072941_1162185 | 3300005201 | Bacteria | 1390 |
| 42 | Ga0466720_195191 | 3300042607 | Bacteria | 24276 |
| 43 | Ga0466705_150144 | 3300042612 | Bacteria | 5820 |
| 44 | Ga0123356_10000424 | 3300010049 | Bacteria | 48165 |
| 45 | Ga0123353_10761392 | 3300010167 | Bacteria | 1345 |
| 46 | Ga0123353_10998328 | 3300010167 | Bacteria | 1125 |
| 47 | Ga0466703_007987 | 3300042636 | Bacteria | 2519 |
| 48 | Ga0466703_359189 | 3300042636 | Bacteria | 7606 |
| 49 | Ga0466708_447093 | 3300042652 | Bacteria | 8546 |
| 50 | Ga0466728_158858 | 3300042620 | Bacteria | 3710 |
| 51 | AustNasuHG_c1002255 | 3300000089 | Bacteria | 6956 |
| 52 | Ga0074263_107073 | 3300005485 | Bacteria | 1116 |
| 53 | Ga0074263_112801 | 3300005485 | Bacteria | 5666 |
| 54 | Ga0466719_576151 | 3300042606 | Bacteria | 2476 |
| 55 | Ga0123356_10062578 | 3300010049 | Bacteria | 3476 |
| 56 | Ga0466702_143418 | 3300042635 | Bacteria | 2614 |
| 57 | Ga0466727_195159 | 3300042655 | Bacteria | 3226 |
| 58 | Ga0466691_072273 | 3300042593 | Bacteria | 9697 |
| 59 | Ga0466694_253708 | 3300042594 | Bacteria | 1889 |
| 60 | Ga0466699_256507 | 3300042597 | Bacteria | 1602 |
| 61 | Ga0466718_015835 | 3300042617 | Bacteria | 1600 |
| 62 | JGI24698J34947_10000513 | 3300002449 | Bacteria | 18247 |
| 63 | JGI24698J34947_10076836 | 3300002449 | Unclassified | 1581 |
| 64 | JGI24695J34938_10001451 | 3300002450 | Bacteria | 20065 |
| 65 | Ga0072940_1033673 | 3300005200 | Bacteria | 1837 |
| 66 | Ga0072940_1278768 | 3300005200 | Bacteria | 1088 |
| 67 | Ga0466732_004755 | 3300042656 | Bacteria | 20938 |
| 68 | Ga0466703_307224 | 3300042636 | Bacteria | 3440 |
| 69 | Ga0466709_165196 | 3300042648 | Bacteria | 9336 |
| 70 | Ga0264413_106022 | 3300024493 | Bacteria | 11971 |
| 71 | Ga0466712_285021 | 3300042614 | Bacteria | 1764 |
| 72 | Ga0466718_094394 | 3300042617 | Bacteria | 20157 |
| 73 | Ga0466718_132867 | 3300042617 | Bacteria | 1536 |
| 74 | Ga0466723_044427 | 3300042618 | Bacteria | 3793 |
| 75 | Ga0466723_191752 | 3300042618 | Bacteria | 6030 |
| 76 | JGI24698J34947_10001176 | 3300002449 | Bacteria | 13650 |
| 77 | JGI24698J34947_10048937 | 3300002449 | Bacteria | 2138 |
| 78 | JGI24695J34938_10000146 | 3300002450 | Bacteria | 64039 |
| 79 | JGI24695J34938_10000446 | 3300002450 | Bacteria | 39944 |
| 80 | Ga0072941_1016635 | 3300005201 | Bacteria | 20897 |
| 81 | Ga0072941_1021165 | 3300005201 | Unclassified | 4690 |
| 82 | Ga0072941_1047970 | 3300005201 | Unclassified | 5804 |
| 83 | Ga0466720_024663 | 3300042607 | Bacteria | 19387 |
| 84 | Ga0466720_043133 | 3300042607 | Unclassified | 5951 |
| 85 | Ga0123356_10000070 | 3300010049 | Bacteria | 107100 |
| 86 | Ga0123356_10358808 | 3300010049 | Bacteria | 1584 |
| 87 | Ga0123353_10046891 | 3300010167 | Bacteria | 6870 |
| 88 | Ga0123353_10071615 | 3300010167 | Bacteria | 5569 |
| 89 | Ga0466704_073621 | 3300042643 | Bacteria | 5969 |
| 90 | Ga0264413_113871 | 3300024493 | Bacteria | 8188 |
| 91 | Ga0466712_116186 | 3300042614 | Bacteria | 2671 |
| 92 | Ga0466712_202175 | 3300042614 | Bacteria | 5980 |
| 93 | Ga0466718_040701 | 3300042617 | Bacteria | 3903 |
| 94 | Ga0466718_094065 | 3300042617 | Bacteria | 3434 |
| 95 | Ga0466718_098896 | 3300042617 | Bacteria | 1527 |
| 96 | IMNBGM34_c003631 | 3300000036 | Bacteria | 2117 |
| 97 | JGI24695J34938_10000129 | 3300002450 | Bacteria | 68011 |
| 98 | JGI24695J34938_10000845 | 3300002450 | Bacteria | 28392 |
| 99 | Ga0072940_1052154 | 3300005200 | Unclassified | 2504 |
| 100 | Ga0074263_110938 | 3300005485 | Bacteria | 1648 |
| 101 | Ga0466720_022983 | 3300042607 | Bacteria | 4646 |
| 102 | Ga0466720_114458 | 3300042607 | Bacteria | 2512 |
| 103 | Ga0123356_10018833 | 3300010049 | Bacteria | 6551 |
| 104 | Ga0466708_430751 | 3300042652 | Bacteria | 9384 |
| 105 | Ga0264413_101276 | 3300024493 | Bacteria | 27033 |
| 106 | Ga0264413_107381 | 3300024493 | Bacteria | 14584 |
| 107 | Ga0415639_242105 | 3300038395 | Unclassified | 2236 |
| 108 | Ga0466690_322412 | 3300042590 | Unclassified | 2024 |
| 109 | Ga0466694_097903 | 3300042594 | Bacteria | 8164 |
| 110 | Ga0466696_079988 | 3300042596 | Bacteria | 8110 |
| 111 | Ga0466696_094655 | 3300042596 | Bacteria | 11377 |
| 112 | Ga0466696_215717 | 3300042596 | Bacteria | 8890 |
| 113 | JGI24695J34938_10000300 | 3300002450 | Bacteria | 48880 |
| 114 | JGI24695J34938_10048541 | 3300002450 | Unclassified | 1869 |
| 115 | Ga0466698_292898 | 3300042610 | Bacteria | 9830 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.